PDB entry 3ne4

View 3ne4 on RCSB PDB site
Description: 1.8 Angstrom structure of intact native wild-type alpha-1-antitrypsin
Class: hydrolase inhibitor
Keywords: alpha1-antitrypsin, serpin, lung disease, liver disease, polymerisation, HYDROLASE INHIBITOR
Deposited on 2010-06-08, released 2011-12-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-12-14, with a file datestamp of 2011-12-09.
Experiment type: XRAY
Resolution: 1.81 Å
R-factor: 0.19
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-1-antitrypsin
    Species: Homo sapiens [TaxId:9606]
    Gene: SERPINA1, 14q32, AAT, PI, PRO0684, PRO2209
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ne4a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ne4A (A:)
    hhhhhhmpssvswgilllaglcclvpvslaedpqgdaaqktdtshhdqdhptfnkitpnl
    aefafslyrqlahqsnstniffspvsiatafamlslgtkadthdeileglnfnlteipea
    qihegfqellrtlnqpdsqlqlttgnglflseglklvdkfledvkklyhseaftvnfgdt
    eeakkqindyvekgtqgkivdlvkeldrdtvfalvnyiffkgkwerpfevkdteeedfhv
    dqvttvkvpmmkrlgmfniqhckklsswvllmkylgnataifflpdegklqhlenelthd
    iitkflenedrrsaslhlpklsitgtydlksvlgqlgitkvfsngadlsgvteeaplkls
    kavhkavltidekgteaagamfleaipmsippevkfnkpfvflmieqntksplfmgkvvn
    ptqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ne4A (A:)
    nkitpnlaefafslyrqlahqsnstniffspvsiatafamlslgtkadthdeileglnfn
    lteipeaqihegfqellrtlnqpdsqlqlttgnglflseglklvdkfledvkklyhseaf
    tvnfgdteeakkqindyvekgtqgkivdlvkeldrdtvfalvnyiffkgkwerpfevkdt
    eeedfhvdqvttvkvpmmkrlgmfniqhckklsswvllmkylgnataifflpdegklqhl
    enelthdiitkflenedrrsaslhlpklsitgtydlksvlgqlgitkvfsngadlsgvte
    eaplklskavhkavltidekgteaagamfleaipmsippevkfnkpfvflmieqntkspl
    fmgkvvnptq