PDB entry 3ne3

View 3ne3 on RCSB PDB site
Description: Mycobacterium tuberculosis Acyl Carrier Protein Synthase Apo structure
Class: transferase
Keywords: acyl carrier protein synthase, acyl carrier protein, fatty acid synthase, ACPS, Mycobacterium Tuberculosis Structural Proteomics Project, Transferase, Structural Genomics, XMTB
Deposited on 2010-06-08, released 2010-07-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-07-25, with a file datestamp of 2012-07-20.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.249
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: Holo-[acyl-carrier-protein] synthase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: acpS, MT2599, MTV009.08c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ne3b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ne3B (B:)
    mgivgvgidlvsipdfaeqvdqpgtvfaetftpgerrdasdksssaarhlaarwaakeav
    ikawsgsrfaqrpvlpedihrdievvtdmwgrprvrltgaiaeyladvtihvslthegdt
    aaavaileap
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ne3B (B:)
    givgvgidlvsipdfaeqvdqpgtvfaetftpgerrdasdksssaarhlaarwaakeavi
    kawsgsrfaqrpvlpedihrdievvtdmwgrprvrltgaiaeyladvtihvslthegdta
    aavaileap