PDB entry 3ne2

View 3ne2 on RCSB PDB site
Description: Archaeoglobus fulgidus aquaporin
Class: transport protein
Keywords: transmembrane helices, water channel, Structural Genomics, PSI-2, Protein Structure Initiative, Center for Structures of Membrane Proteins, CSMP, TRANSPORT PROTEIN
Deposited on 2010-06-08, released 2010-09-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable aquaporin AqpM
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: aqpM, AF_1426
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ne2a_
  • Chain 'B':
    Compound: Probable aquaporin AqpM
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: aqpM, AF_1426
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ne2b_
  • Chain 'C':
    Compound: Probable aquaporin AqpM
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: aqpM, AF_1426
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ne2c_
  • Chain 'D':
    Compound: Probable aquaporin AqpM
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: aqpM, AF_1426
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ne2d_
  • Chain 'E':
    Compound: Probable aquaporin AqpM
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: aqpM, AF_1426
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ne2e_
  • Chain 'F':
    Compound: Probable aquaporin AqpM
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: aqpM, AF_1426
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ne2f_
  • Chain 'G':
    Compound: Probable aquaporin AqpM
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: aqpM, AF_1426
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ne2g_
  • Chain 'H':
    Compound: Probable aquaporin AqpM
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: aqpM, AF_1426
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ne2h_
  • Heterogens: BOG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ne2A (A:)
    mtmtlakrftaevvgtfilvffgpgaavitlmiangadkpnefnigigalgglgdwfaig
    mafalaiaaviyslgrisgahinpavtialwsigrfpgrevvpyivaqfigaalgsllfl
    acvgpaaatvgglgatapfpgigygqailteaigtfllmlvimgvavderappgfaglvi
    gltvggiittignitgsslnpartfgpylgdslmginlwqyfpiyvigpivgavaaawly
    nylake
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ne2A (A:)
    tmtlakrftaevvgtfilvffgpgaavitlmiangadkpnefnigigalgglgdwfaigm
    afalaiaaviyslgrisgahinpavtialwsigrfpgrevvpyivaqfigaalgsllfla
    cvgpaaatvgglgatapfpgigygqailteaigtfllmlvimgvavderappgfaglvig
    ltvggiittignitgsslnpartfgpylgdslmginlwqyfpiyvigpivgavaaawlyn
    ylak
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ne2B (B:)
    mtmtlakrftaevvgtfilvffgpgaavitlmiangadkpnefnigigalgglgdwfaig
    mafalaiaaviyslgrisgahinpavtialwsigrfpgrevvpyivaqfigaalgsllfl
    acvgpaaatvgglgatapfpgigygqailteaigtfllmlvimgvavderappgfaglvi
    gltvggiittignitgsslnpartfgpylgdslmginlwqyfpiyvigpivgavaaawly
    nylake
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ne2B (B:)
    tmtlakrftaevvgtfilvffgpgaavitlmiangadkpnefnigigalgglgdwfaigm
    afalaiaaviyslgrisgahinpavtialwsigrfpgrevvpyivaqfigaalgsllfla
    cvgpaaatvgglgatapfpgigygqailteaigtfllmlvimgvavderappgfaglvig
    ltvggiittignitgsslnpartfgpylgdslmginlwqyfpiyvigpivgavaaawlyn
    ylak
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ne2C (C:)
    mtmtlakrftaevvgtfilvffgpgaavitlmiangadkpnefnigigalgglgdwfaig
    mafalaiaaviyslgrisgahinpavtialwsigrfpgrevvpyivaqfigaalgsllfl
    acvgpaaatvgglgatapfpgigygqailteaigtfllmlvimgvavderappgfaglvi
    gltvggiittignitgsslnpartfgpylgdslmginlwqyfpiyvigpivgavaaawly
    nylake
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3ne2D (D:)
    mtmtlakrftaevvgtfilvffgpgaavitlmiangadkpnefnigigalgglgdwfaig
    mafalaiaaviyslgrisgahinpavtialwsigrfpgrevvpyivaqfigaalgsllfl
    acvgpaaatvgglgatapfpgigygqailteaigtfllmlvimgvavderappgfaglvi
    gltvggiittignitgsslnpartfgpylgdslmginlwqyfpiyvigpivgavaaawly
    nylake
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ne2D (D:)
    tmtlakrftaevvgtfilvffgpgaavitlmiangadkpnefnigigalgglgdwfaigm
    afalaiaaviyslgrisgahinpavtialwsigrfpgrevvpyivaqfigaalgsllfla
    cvgpaaatvgglgatapfpgigygqailteaigtfllmlvimgvavderappgfaglvig
    ltvggiittignitgsslnpartfgpylgdslmginlwqyfpiyvigpivgavaaawlyn
    ylak
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3ne2E (E:)
    mtmtlakrftaevvgtfilvffgpgaavitlmiangadkpnefnigigalgglgdwfaig
    mafalaiaaviyslgrisgahinpavtialwsigrfpgrevvpyivaqfigaalgsllfl
    acvgpaaatvgglgatapfpgigygqailteaigtfllmlvimgvavderappgfaglvi
    gltvggiittignitgsslnpartfgpylgdslmginlwqyfpiyvigpivgavaaawly
    nylake
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ne2E (E:)
    mtmtlakrftaevvgtfilvffgpgaavitlmiangadkpnefnigigalgglgdwfaig
    mafalaiaaviyslgrisgahinpavtialwsigrfpgrevvpyivaqfigaalgsllfl
    acvgpaaatvgglgatapfpgigygqailteaigtfllmlvimgvavderappgfaglvi
    gltvggiittignitgsslnpartfgpylgdslmginlwqyfpiyvigpivgavaaawly
    nylak
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3ne2F (F:)
    mtmtlakrftaevvgtfilvffgpgaavitlmiangadkpnefnigigalgglgdwfaig
    mafalaiaaviyslgrisgahinpavtialwsigrfpgrevvpyivaqfigaalgsllfl
    acvgpaaatvgglgatapfpgigygqailteaigtfllmlvimgvavderappgfaglvi
    gltvggiittignitgsslnpartfgpylgdslmginlwqyfpiyvigpivgavaaawly
    nylake
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ne2F (F:)
    tmtlakrftaevvgtfilvffgpgaavitlmiangadkpnefnigigalgglgdwfaigm
    afalaiaaviyslgrisgahinpavtialwsigrfpgrevvpyivaqfigaalgsllfla
    cvgpaaatvgglgatapfpgigygqailteaigtfllmlvimgvavderappgfaglvig
    ltvggiittignitgsslnpartfgpylgdslmginlwqyfpiyvigpivgavaaawlyn
    ylak
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3ne2G (G:)
    mtmtlakrftaevvgtfilvffgpgaavitlmiangadkpnefnigigalgglgdwfaig
    mafalaiaaviyslgrisgahinpavtialwsigrfpgrevvpyivaqfigaalgsllfl
    acvgpaaatvgglgatapfpgigygqailteaigtfllmlvimgvavderappgfaglvi
    gltvggiittignitgsslnpartfgpylgdslmginlwqyfpiyvigpivgavaaawly
    nylake
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ne2G (G:)
    tmtlakrftaevvgtfilvffgpgaavitlmiangadkpnefnigigalgglgdwfaigm
    afalaiaaviyslgrisgahinpavtialwsigrfpgrevvpyivaqfigaalgsllfla
    cvgpaaatvgglgatapfpgigygqailteaigtfllmlvimgvavderappgfaglvig
    ltvggiittignitgsslnpartfgpylgdslmginlwqyfpiyvigpivgavaaawlyn
    ylak
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3ne2H (H:)
    mtmtlakrftaevvgtfilvffgpgaavitlmiangadkpnefnigigalgglgdwfaig
    mafalaiaaviyslgrisgahinpavtialwsigrfpgrevvpyivaqfigaalgsllfl
    acvgpaaatvgglgatapfpgigygqailteaigtfllmlvimgvavderappgfaglvi
    gltvggiittignitgsslnpartfgpylgdslmginlwqyfpiyvigpivgavaaawly
    nylake
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ne2H (H:)
    tmtlakrftaevvgtfilvffgpgaavitlmiangadkpnefnigigalgglgdwfaigm
    afalaiaaviyslgrisgahinpavtialwsigrfpgrevvpyivaqfigaalgsllfla
    cvgpaaatvgglgatapfpgigygqailteaigtfllmlvimgvavderappgfaglvig
    ltvggiittignitgsslnpartfgpylgdslmginlwqyfpiyvigpivgavaaawlyn
    ylak