PDB entry 3ne0

View 3ne0 on RCSB PDB site
Description: Structure and functional regulation of RipA, a mycobacterial enzyme essential for daughter cell separation
Deposited on 2010-06-08, released 2010-09-22
The last revision was dated 2010-09-22, with a file datestamp of 2010-09-17.
Experiment type: XRAY
Resolution: 1 Å
R-factor: 0.111
AEROSPACI score: 1.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Resuscitation promoting factor Interacting Protein A
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: rv1477
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3ne0A (A:)
    gamgwdglwdptlpmipsanipgdpiavvnqvlgisatsaqvtanmgrkfleqlgilqpt
    dtgitnapagsaqgriprvygrqaseyvirrgmsqigvpyswgggnaagpskgidsgagt
    vgfdcsglvlysfagvgiklphysgsqynlgrkipssqmrrgdvifygpngsqhvtiylg
    ngqmleapdvglkvrvapvrtagmtpyvvryiey
    

    Sequence, based on observed residues (ATOM records):
    >3ne0A (A:)
    glwdptlpmipsanipgdpiavvnqvlgisatsaqvtanmgrkfleqlgilqptdtgitn
    apagsaqgriprvygrqaseyvirrgmsqigvpyswgggnaagpskgidsgagtvgfdcs
    glvlysfagvgiklphysgsqynlgrkipssqmrrgdvifygpngsqhvtiylgngqmle
    apdvglkvrvapvrtagmtpyvvryiey