PDB entry 3ndz

View 3ndz on RCSB PDB site
Description: The structure of the catalytic and carbohydrate binding domain of endoglucanase D from Clostridium cellulovorans bound to cellotriose
Class: hydrolase
Keywords: cellotriose, endoglucanase, xylanase, carbohydrate binding domain, glucanase, HYDROLASE
Deposited on 2010-06-08, released 2011-06-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-06-29, with a file datestamp of 2011-06-24.
Experiment type: XRAY
Resolution: 2.08 Å
R-factor: 0.146
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endoglucanase D
    Species: Clostridium cellulovorans [TaxId:1493]
    Gene: engD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ndza_
  • Chain 'B':
    Compound: Endoglucanase D
    Species: Clostridium cellulovorans [TaxId:1493]
    Gene: engD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ndzb_
  • Chain 'C':
    Compound: Endoglucanase D
    Species: Clostridium cellulovorans [TaxId:1493]
    Gene: engD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ndzc_
  • Chain 'D':
    Compound: Endoglucanase D
    Species: Clostridium cellulovorans [TaxId:1493]
    Gene: engD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ndzd_
  • Chain 'E':
    Compound: Endoglucanase D
    Species: Clostridium cellulovorans [TaxId:1493]
    Gene: engD
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Endoglucanase D
    Species: Clostridium cellulovorans [TaxId:1493]
    Gene: engD
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Endoglucanase D
    Species: Clostridium cellulovorans [TaxId:1493]
    Gene: engD
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Endoglucanase D
    Species: Clostridium cellulovorans [TaxId:1493]
    Gene: engD
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CT3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ndzA (A:)
    staftgvrdvpaqqivnemkvgwnlgntmdaiggetnwgnpmtthaminkikeagfntlr
    lpvtwdghmgaapeytidqtwmkrveeianyafdndmyviinlhhenewlkpfyaneaqv
    kaqltkvwtqiannfkkygdhlifetmneprpvgaslqwtggsyenrevvnrynltavna
    iratggnnatryimvptlaasamsttindlvipnndskvivslhmyspyffamdingtss
    wgsdydkssldsefdavynkfvkngravvigemgsinknntaarvthaeyyaksakargl
    tpiwwdngysvagkaetfgifnrsnltwdapevmkafikgiggss
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ndzB (B:)
    staftgvrdvpaqqivnemkvgwnlgntmdaiggetnwgnpmtthaminkikeagfntlr
    lpvtwdghmgaapeytidqtwmkrveeianyafdndmyviinlhhenewlkpfyaneaqv
    kaqltkvwtqiannfkkygdhlifetmneprpvgaslqwtggsyenrevvnrynltavna
    iratggnnatryimvptlaasamsttindlvipnndskvivslhmyspyffamdingtss
    wgsdydkssldsefdavynkfvkngravvigemgsinknntaarvthaeyyaksakargl
    tpiwwdngysvagkaetfgifnrsnltwdapevmkafikgiggss
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ndzC (C:)
    staftgvrdvpaqqivnemkvgwnlgntmdaiggetnwgnpmtthaminkikeagfntlr
    lpvtwdghmgaapeytidqtwmkrveeianyafdndmyviinlhhenewlkpfyaneaqv
    kaqltkvwtqiannfkkygdhlifetmneprpvgaslqwtggsyenrevvnrynltavna
    iratggnnatryimvptlaasamsttindlvipnndskvivslhmyspyffamdingtss
    wgsdydkssldsefdavynkfvkngravvigemgsinknntaarvthaeyyaksakargl
    tpiwwdngysvagkaetfgifnrsnltwdapevmkafikgiggss
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ndzD (D:)
    staftgvrdvpaqqivnemkvgwnlgntmdaiggetnwgnpmtthaminkikeagfntlr
    lpvtwdghmgaapeytidqtwmkrveeianyafdndmyviinlhhenewlkpfyaneaqv
    kaqltkvwtqiannfkkygdhlifetmneprpvgaslqwtggsyenrevvnrynltavna
    iratggnnatryimvptlaasamsttindlvipnndskvivslhmyspyffamdingtss
    wgsdydkssldsefdavynkfvkngravvigemgsinknntaarvthaeyyaksakargl
    tpiwwdngysvagkaetfgifnrsnltwdapevmkafikgiggss
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.