PDB entry 3ndv

View 3ndv on RCSB PDB site
Description: Crystal structure of the N-terminal beta-aminopeptidase BapA in complex with ampicillin
Class: hydrolase/antibiotic
Keywords: Ntn-hydrolase, beta-aminopeptidase, beta-peptide, alpha-beta-beta-alpha sandwich, N-terminal beta-aminopeptidase, HYDROLASE-ANTIBIOTIC complex
Deposited on 2010-06-08, released 2011-09-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-09-28, with a file datestamp of 2011-09-23.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.168
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-peptidyl aminopeptidase
    Species: Sphingosinicella xenopeptidilytica [TaxId:364098]
    Gene: bapA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ndva_
  • Chain 'B':
    Compound: Beta-peptidyl aminopeptidase
    Species: Sphingosinicella xenopeptidilytica [TaxId:364098]
    Gene: bapA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ndvb_
  • Chain 'C':
    Compound: Beta-peptidyl aminopeptidase
    Species: Sphingosinicella xenopeptidilytica [TaxId:364098]
    Gene: bapA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ndvc_
  • Chain 'D':
    Compound: Beta-peptidyl aminopeptidase
    Species: Sphingosinicella xenopeptidilytica [TaxId:364098]
    Gene: bapA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ndvd_
  • Heterogens: GOL, AIC, NDV, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ndvA (A:)
    gprardlgvpfegtpgalnaitdvagvevghttvisgdgamvigkgpyrtgvtiihplgk
    tsldgvaagravingtgewtgmhlvdevgqflgpialtgtgnvglvhqsmmdwsvgkvpe
    ealfsrllpvvaetldnrlndvfghgltrdhvfaaldgakggpvaegnvgggtgmiaytf
    kggigtssrvvsagdtrytvgvlvqanhgdrndlriagvqigkeikgawpevngivaagp
    dagkpqdknslliviatdaplmphqlermarraalgvgrngstagalsgefalafstshv
    iplggkprlpaiindtdsetmnalfrgvvqateealvnqlvasetmtgannakvygiphd
    qlarimkarfprr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ndvA (A:)
    gprardlgvpfegtpgalnaitdvagvevghttvisgdgamvigkgpyrtgvtiihplgk
    tsldgvaagravingtgewtgmhlvdevgqflgpialtgtgnvglvhqsmmdwsvgkvpe
    ealfsrllpvvaetldnrlndvfghgltrdhvfaaldgakggpvaegnvgggtgmiaytf
    kggigtssrvvsagdtrytvgvlvqanhgdrndlriagvqigkeikgawpevngivaagp
    dagkpslliviatdaplmphqlermarraalgvgrngstagalsgefalafstshviplg
    gkprlpaiindtdsetmnalfrgvvqateealvnqlvasetmtgannakvygiphdqlar
    imkarfp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ndvB (B:)
    gprardlgvpfegtpgalnaitdvagvevghttvisgdgamvigkgpyrtgvtiihplgk
    tsldgvaagravingtgewtgmhlvdevgqflgpialtgtgnvglvhqsmmdwsvgkvpe
    ealfsrllpvvaetldnrlndvfghgltrdhvfaaldgakggpvaegnvgggtgmiaytf
    kggigtssrvvsagdtrytvgvlvqanhgdrndlriagvqigkeikgawpevngivaagp
    dagkpqdknslliviatdaplmphqlermarraalgvgrngstagalsgefalafstshv
    iplggkprlpaiindtdsetmnalfrgvvqateealvnqlvasetmtgannakvygiphd
    qlarimkarfprr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ndvB (B:)
    gprardlgvpfegtpgalnaitdvagvevghttvisgdgamvigkgpyrtgvtiihplgk
    tsldgvaagravingtgewtgmhlvdevgqflgpialtgtgnvglvhqsmmdwsvgkvpe
    ealfsrllpvvaetldnrlndvfghgltrdhvfaaldgakggpvaegnvgggtgmiaytf
    kggigtssrvvsagdtrytvgvlvqanhgdrndlriagvqigkeikgawpevngivaagp
    dagslliviatdaplmphqlermarraalgvgrngstagalsgefalafstshviplggk
    prlpaiindtdsetmnalfrgvvqateealvnqlvasetmtgannakvygiphdqlarim
    karfp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3ndvC (C:)
    gprardlgvpfegtpgalnaitdvagvevghttvisgdgamvigkgpyrtgvtiihplgk
    tsldgvaagravingtgewtgmhlvdevgqflgpialtgtgnvglvhqsmmdwsvgkvpe
    ealfsrllpvvaetldnrlndvfghgltrdhvfaaldgakggpvaegnvgggtgmiaytf
    kggigtssrvvsagdtrytvgvlvqanhgdrndlriagvqigkeikgawpevngivaagp
    dagkpqdknslliviatdaplmphqlermarraalgvgrngstagalsgefalafstshv
    iplggkprlpaiindtdsetmnalfrgvvqateealvnqlvasetmtgannakvygiphd
    qlarimkarfprr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ndvC (C:)
    gprardlgvpfegtpgalnaitdvagvevghttvisgdgamvigkgpyrtgvtiihplgk
    tsldgvaagravingtgewtgmhlvdevgqflgpialtgtgnvglvhqsmmdwsvgkvpe
    ealfsrllpvvaetldnrlndvfghgltrdhvfaaldgakggpvaegnvgggtgmiaytf
    kggigtssrvvsagdtrytvgvlvqanhgdrndlriagvqigkeikgawpevngivaagp
    dagkslliviatdaplmphqlermarraalgvgrngstagalsgefalafstshviplgg
    kprlpaiindtdsetmnalfrgvvqateealvnqlvasetmtgannakvygiphdqlari
    mkarfp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3ndvD (D:)
    gprardlgvpfegtpgalnaitdvagvevghttvisgdgamvigkgpyrtgvtiihplgk
    tsldgvaagravingtgewtgmhlvdevgqflgpialtgtgnvglvhqsmmdwsvgkvpe
    ealfsrllpvvaetldnrlndvfghgltrdhvfaaldgakggpvaegnvgggtgmiaytf
    kggigtssrvvsagdtrytvgvlvqanhgdrndlriagvqigkeikgawpevngivaagp
    dagkpqdknslliviatdaplmphqlermarraalgvgrngstagalsgefalafstshv
    iplggkprlpaiindtdsetmnalfrgvvqateealvnqlvasetmtgannakvygiphd
    qlarimkarfprr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ndvD (D:)
    gprardlgvpfegtpgalnaitdvagvevghttvisgdgamvigkgpyrtgvtiihplgk
    tsldgvaagravingtgewtgmhlvdevgqflgpialtgtgnvglvhqsmmdwsvgkvpe
    ealfsrllpvvaetldnrlndvfghgltrdhvfaaldgakggpvaegnvgggtgmiaytf
    kggigtssrvvsagdtrytvgvlvqanhgdrndlriagvqigkeikgawpevngivaagp
    dagkpslliviatdaplmphqlermarraalgvgrngstagalsgefalafstshviplg
    gkprlpaiindtdsetmnalfrgvvqateealvnqlvasetmtgannakvygiphdqlar
    imkarfp