PDB entry 3ndu

View 3ndu on RCSB PDB site
Description: HIV-1 Protease Saquinavir:Ritonavir 1:5 complex structure
Class: hydrolase/hydrolase inhibitor
Keywords: HIV-1 PROTEASE, HYDROLASE, AIDS, ASPARTYL PROTEASE, SAQUINAVIR, CARBAMYLATION, hydrolase-hydrolase inhibitor complex
Deposited on 2010-06-08, released 2011-07-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-12-07, with a file datestamp of 2011-12-02.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: 0.142
AEROSPACI score: 0.81 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7SSI0 (0-98)
      • insertion (0)
      • engineered mutation (7)
      • engineered mutation (33)
      • engineered mutation (63)
      • engineered mutation (67)
      • engineered mutation (95)
      • engineered mutation (6)
      • engineered mutation (32)
      • engineered mutation (62)
      • engineered mutation (66)
      • engineered mutation (94)
    Domains in SCOPe 2.07: d3ndua_
  • Chain 'B':
    Compound: Protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7SSI0 (0-98)
      • insertion (0)
      • engineered mutation (7)
      • engineered mutation (33)
      • engineered mutation (63)
      • engineered mutation (67)
      • engineered mutation (95)
      • engineered mutation (6)
      • engineered mutation (32)
      • engineered mutation (62)
      • engineered mutation (66)
      • engineered mutation (94)
    Domains in SCOPe 2.07: d3ndub_
  • Chain 'C':
    Compound: Protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7SSI0 (1-99)
      • insertion (1)
      • engineered mutation (8)
      • engineered mutation (34)
      • engineered mutation (64)
      • engineered mutation (68)
      • engineered mutation (96)
      • engineered mutation (7)
      • engineered mutation (33)
      • engineered mutation (63)
      • engineered mutation (67)
      • engineered mutation (95)
    Domains in SCOPe 2.07: d3nduc_
  • Chain 'D':
    Compound: Protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7SSI0 (1-99)
      • insertion (1)
      • engineered mutation (8)
      • engineered mutation (34)
      • engineered mutation (64)
      • engineered mutation (68)
      • engineered mutation (96)
      • engineered mutation (7)
      • engineered mutation (33)
      • engineered mutation (63)
      • engineered mutation (67)
      • engineered mutation (95)
    Domains in SCOPe 2.07: d3ndud_
  • Heterogens: ROC, DMS, ACT, CL, GOL, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nduA (A:)
    xpqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqy
    dqiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nduB (B:)
    xpqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqy
    dqiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3nduC (C:)
    xpqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqy
    dqiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nduC (C:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
    qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3nduD (D:)
    xpqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqy
    dqiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nduD (D:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkmiggiggfikvrqyd
    qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf