PDB entry 3nds

View 3nds on RCSB PDB site
Description: Crystal structure of engineered Naja Nigricollis toxin alpha
Deposited on 2010-06-08, released 2010-08-11
The last revision was dated 2011-04-06, with a file datestamp of 2011-04-01.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.172
AEROSPACI score: 0.8 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: short neurotoxin 1
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01426 (0-61)
      • insertion (17)
  • Heterogens: MPD, SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3ndsA (A:)
    lechnqqssqppttktcspgetncykkvwrdhrgtiiergcgcptvkpgiklnccttdkc
    nn