PDB entry 3ndr

View 3ndr on RCSB PDB site
Description: Crystal structure of tetrameric pyridoxal 4-dehydrogenase from Mesorhizobium loti
Class: oxidoreductase
Keywords: PYRIDOXAL, tPLDH, 4-PYRIDOXOLACTONE, SHORT CHAIN DEHYDROGENASE/REDUCTASE, OXIDOREDUCTASE
Deposited on 2010-06-08, released 2011-06-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-06-08, with a file datestamp of 2011-06-03.
Experiment type: XRAY
Resolution: 2.88 Å
R-factor: 0.188
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-oxoacyl-(acyl-carrier protein) reductase
    Species: Mesorhizobium loti [TaxId:381]
    Gene: mlr6807, pldh-t
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ndra_
  • Chain 'B':
    Compound: 3-oxoacyl-(acyl-carrier protein) reductase
    Species: Mesorhizobium loti [TaxId:381]
    Gene: mlr6807, pldh-t
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ndrb_
  • Chain 'C':
    Compound: 3-oxoacyl-(acyl-carrier protein) reductase
    Species: Mesorhizobium loti [TaxId:381]
    Gene: mlr6807, pldh-t
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ndrc_
  • Chain 'D':
    Compound: 3-oxoacyl-(acyl-carrier protein) reductase
    Species: Mesorhizobium loti [TaxId:381]
    Gene: mlr6807, pldh-t
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ndrd_
  • Heterogens: NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ndrA (A:)
    terlagktalvtgaaqgigkaiaarlaadgatvivsdinaegakaaaasigkkaraiaad
    isdpgsvkalfaeiqaltggidilvnnasivpfvawddvdldhwrkiidvnltgtfivtr
    agtdqmraagkagrvisiasntffagtpnmaayvaakggvigftralatelgkynitana
    vtpgliesdgvkasphneafgfvemlqamkgkgqpehiadvvsflasddarwitgqtlnv
    dagmvrh
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ndrB (B:)
    terlagktalvtgaaqgigkaiaarlaadgatvivsdinaegakaaaasigkkaraiaad
    isdpgsvkalfaeiqaltggidilvnnasivpfvawddvdldhwrkiidvnltgtfivtr
    agtdqmraagkagrvisiasntffagtpnmaayvaakggvigftralatelgkynitana
    vtpgliesdgvkasphneafgfvemlqamkgkgqpehiadvvsflasddarwitgqtlnv
    dagmvrh
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ndrC (C:)
    terlagktalvtgaaqgigkaiaarlaadgatvivsdinaegakaaaasigkkaraiaad
    isdpgsvkalfaeiqaltggidilvnnasivpfvawddvdldhwrkiidvnltgtfivtr
    agtdqmraagkagrvisiasntffagtpnmaayvaakggvigftralatelgkynitana
    vtpgliesdgvkasphneafgfvemlqamkgkgqpehiadvvsflasddarwitgqtlnv
    dagmvrh
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ndrD (D:)
    terlagktalvtgaaqgigkaiaarlaadgatvivsdinaegakaaaasigkkaraiaad
    isdpgsvkalfaeiqaltggidilvnnasivpfvawddvdldhwrkiidvnltgtfivtr
    agtdqmraagkagrvisiasntffagtpnmaayvaakggvigftralatelgkynitana
    vtpgliesdgvkasphneafgfvemlqamkgkgqpehiadvvsflasddarwitgqtlnv
    dagmvrh