PDB entry 3ndq

View 3ndq on RCSB PDB site
Description: Structure of Human TFIIS Domain II
Deposited on 2010-06-07, released 2011-05-18
The last revision was dated 2011-05-18, with a file datestamp of 2011-05-13.
Experiment type: XRAY
Resolution: 1.93 Å
R-factor: 0.168
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcription elongation factor A protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: GTF2S, TCEA1, TFIIS
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3ndqA (A:)
    gidpftprapstsdsvrlkcremlaaalrtgddyiaigadeeelgsqieeaiyqeirntd
    mkyknrvrsrisnlkdaknpnlrknvlcgnippdlfarmtaeemasde
    

    Sequence, based on observed residues (ATOM records):
    >3ndqA (A:)
    rapstsdsvrlkcremlaaalrtgddyiaigadeeelgsqieeaiyqeirntdmkyknrv
    rsrisnlkdaknpnlrknvlcgnippdlfarmtaeem