PDB entry 3ndn

View 3ndn on RCSB PDB site
Description: Crystal structure of O-succinylhomoserine sulfhydrylase from Mycobacterium tuberculosis covalently bound to pyridoxal-5-phosphate
Class: lyase
Keywords: Seattle Structural Genomics Center for Infectious Disease, SSGCID, mycobacterium, tuberculosis, PLP, Schiff base, transamination, LYASE
Deposited on 2010-06-07, released 2010-06-16
The last revision prior to the SCOPe 2.05 freeze date was dated 2010-06-16, with a file datestamp of 2010-06-11.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.189
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: O-succinylhomoserine sulfhydrylase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: metZ, MT0402, Rv0391
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3ndna_
  • Chain 'B':
    Compound: O-succinylhomoserine sulfhydrylase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: metZ, MT0402, Rv0391
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3ndnb_
  • Chain 'C':
    Compound: O-succinylhomoserine sulfhydrylase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: metZ, MT0402, Rv0391
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3ndnc_
  • Chain 'D':
    Compound: O-succinylhomoserine sulfhydrylase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: metZ, MT0402, Rv0391
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3ndnd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ndnA (A:)
    mahhhhhhmtdessvrtpkalpdgvsqatvgvrggmlrsgfeetaeamyltsgyvygsaa
    vaeksfageldhyvysrygnptvsvfeerlrliegapaafatasgmaavftslgallgag
    drlvaarslfgscfvvcseilprwgvqtvfvdgddlsqweralsvptqavffetpsnpmq
    slvdiaavtelahaagakvvldnvfatpllqqgfplgvdvvvysgtkhidgqgrvlggai
    lgdreyidgpvqklmrhtgpamsafnawvllkgletlairvqhsnasaqriaeflnghps
    vrwvrypylpshpqydlakrqmsgggtvvtfaldcpedvakqrafevldkmrlidisnnl
    gdakslvthpattthramgpegraaiglgdgvvrisvgledtddliadidrals
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ndnA (A:)
    svrtpkalpdgvsqatvgvrggmlrsgfeetaeamyltsgyvygsaavaeksfageldhy
    vysrygnptvsvfeerlrliegapaafatasgmaavftslgallgagdrlvaarslfgsc
    fvvcseilprwgvqtvfvdgddlsqweralsvptqavffetpsnpmqslvdiaavtelah
    aagakvvldnvfatpllqqgfplgvdvvvysgtkhidgqgrvlggailgdreyidgpvqk
    lmrhtgpamsafnawvllkgletlairvqhsnasaqriaeflnghpsvrwvrypylpshp
    qydlakrqmsgggtvvtfaldcpedvakqrafevldkmrlidisnnlgdakslvthpatt
    thramgpegraaiglgdgvvrisvgledtddliadidrals
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ndnB (B:)
    mahhhhhhmtdessvrtpkalpdgvsqatvgvrggmlrsgfeetaeamyltsgyvygsaa
    vaeksfageldhyvysrygnptvsvfeerlrliegapaafatasgmaavftslgallgag
    drlvaarslfgscfvvcseilprwgvqtvfvdgddlsqweralsvptqavffetpsnpmq
    slvdiaavtelahaagakvvldnvfatpllqqgfplgvdvvvysgtkhidgqgrvlggai
    lgdreyidgpvqklmrhtgpamsafnawvllkgletlairvqhsnasaqriaeflnghps
    vrwvrypylpshpqydlakrqmsgggtvvtfaldcpedvakqrafevldkmrlidisnnl
    gdakslvthpattthramgpegraaiglgdgvvrisvgledtddliadidrals
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ndnB (B:)
    svrtpkalpdgvsqatvgvrggmlrsgfeetaeamyltsgyvygsaavaeksfageldhy
    vysrygnptvsvfeerlrliegapaafatasgmaavftslgallgagdrlvaarslfgsc
    fvvcseilprwgvqtvfvdgddlsqweralsvptqavffetpsnpmqslvdiaavtelah
    aagakvvldnvfatpllqqgfplgvdvvvysgtkhidgqgrvlggailgdreyidgpvqk
    lmrhtgpamsafnawvllkgletlairvqhsnasaqriaeflnghpsvrwvrypylpshp
    qydlakrqmsgggtvvtfaldcpedvakqrafevldkmrlidisnnlgdakslvthpatt
    thramgpegraaiglgdgvvrisvgledtddliadidrals
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3ndnC (C:)
    mahhhhhhmtdessvrtpkalpdgvsqatvgvrggmlrsgfeetaeamyltsgyvygsaa
    vaeksfageldhyvysrygnptvsvfeerlrliegapaafatasgmaavftslgallgag
    drlvaarslfgscfvvcseilprwgvqtvfvdgddlsqweralsvptqavffetpsnpmq
    slvdiaavtelahaagakvvldnvfatpllqqgfplgvdvvvysgtkhidgqgrvlggai
    lgdreyidgpvqklmrhtgpamsafnawvllkgletlairvqhsnasaqriaeflnghps
    vrwvrypylpshpqydlakrqmsgggtvvtfaldcpedvakqrafevldkmrlidisnnl
    gdakslvthpattthramgpegraaiglgdgvvrisvgledtddliadidrals
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ndnC (C:)
    svrtpkalpdgvsqatvgvrggmlrsgfeetaeamyltsgyvygsaavaeksfageldhy
    vysrygnptvsvfeerlrliegapaafatasgmaavftslgallgagdrlvaarslfgsc
    fvvcseilprwgvqtvfvdgddlsqweralsvptqavffetpsnpmqslvdiaavtelah
    aagakvvldnvfatpllqqgfplgvdvvvysgtkhidgqgrvlggailgdreyidgpvqk
    lmrhtgpamsafnawvllkgletlairvqhsnasaqriaeflnghpsvrwvrypylpshp
    qydlakrqmsgggtvvtfaldcpedvakqrafevldkmrlidisnnlgdakslvthpatt
    thramgpegraaiglgdgvvrisvgledtddliadidrals
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3ndnD (D:)
    mahhhhhhmtdessvrtpkalpdgvsqatvgvrggmlrsgfeetaeamyltsgyvygsaa
    vaeksfageldhyvysrygnptvsvfeerlrliegapaafatasgmaavftslgallgag
    drlvaarslfgscfvvcseilprwgvqtvfvdgddlsqweralsvptqavffetpsnpmq
    slvdiaavtelahaagakvvldnvfatpllqqgfplgvdvvvysgtkhidgqgrvlggai
    lgdreyidgpvqklmrhtgpamsafnawvllkgletlairvqhsnasaqriaeflnghps
    vrwvrypylpshpqydlakrqmsgggtvvtfaldcpedvakqrafevldkmrlidisnnl
    gdakslvthpattthramgpegraaiglgdgvvrisvgledtddliadidrals
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ndnD (D:)
    svrtpkalpdgvsqatvgvrggmlrsgfeetaeamyltsgyvygsaavaeksfageldhy
    vysrygnptvsvfeerlrliegapaafatasgmaavftslgallgagdrlvaarslfgsc
    fvvcseilprwgvqtvfvdgddlsqweralsvptqavffetpsnpmqslvdiaavtelah
    aagakvvldnvfatpllqqgfplgvdvvvysgtkhidgqgrvlggailgdreyidgpvqk
    lmrhtgpamsafnawvllkgletlairvqhsnasaqriaeflnghpsvrwvrypylpshp
    qydlakrqmsgggtvvtfaldcpedvakqrafevldkmrlidisnnlgdakslvthpatt
    thramgpegraaiglgdgvvrisvgledtddliadidrals