PDB entry 3ndj

View 3ndj on RCSB PDB site
Description: X-ray Structure of a C-3'-Methyltransferase in Complex with S-Adenosyl-L-Homocysteine and Sugar Product
Class: transferase
Keywords: S-adenosyl-L-homocysteine, kijanose, tetronitrose, tetradeoxy sugar, keto sugar, Micromonospora chalcea, TcaB9, C-3'-Methyltransferase, Sugar methylation, TRANSFERASE
Deposited on 2010-06-07, released 2010-06-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-05-23, with a file datestamp of 2012-05-18.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.205
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methyltransferase
    Species: Micromonospora chalcea [TaxId:1874]
    Gene: tcab9
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ndja_
  • Heterogens: SAH, ZN, PO4, JHZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ndjA (A:)
    ghmshladvspptacrvcgggvqefldlgrqplsdrfrkpdelddeftyrlavgrcdsce
    mvqlteevprdlmfhevypyhssgssvmrehfamlardflateltgpdpfiveigcndgi
    mlrtiqeagvrhlgfepssgvaakarekgirvrtdffekataddvrrtegpanviyaant
    lchipyvqsvlegvdallapdgvfvfedpylgdivaktsfdqiydehfflfsatsvqgma
    qrcgfelvdvqrlpvhggevrytlarqgsrtpsaavaqllaaereqelsdmatlrafagn
    vvkirdeltallhrlraegrsvvgygataksatvtnfcgigpdlvhsvydttpdkqnrlt
    pgahipvrpasafsdpypdyallfawnhaeeimakeqefhqaggrwilyvpevhir
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ndjA (A:)
    ptacrvcgggvqefldlgrqplsdrfrkpdelddeftyrlavgrcdscemvqlteevprd
    lmfhevypyhssgssvmrehfamlardflateltgpdpfiveigcndgimlrtiqeagvr
    hlgfepssgvaakarekgirvrtdffekataddvrrtegpanviyaantlchipyvqsvl
    egvdallapdgvfvfedpylgdivaktsfdqiydehfflfsatsvqgmaqrcgfelvdvq
    rlpvhggevrytlarqgsrtpsaavaqllaaereqelsdmatlrafagnvvkirdeltal
    lhrlraegrsvvgygataksatvtnfcgigpdlvhsvydttpdkqnrltpgahipvrpas
    afsdpypdyallfawnhaeeimakeqefhqaggrwilyvpevhir