PDB entry 3ndi

View 3ndi on RCSB PDB site
Description: X-ray Structure of a C-3'-Methyltransferase in Complex with S-adenosylmethionine and dTMP
Class: transferase
Keywords: S-adenosylmethionine, kijanose, tetronitrose, tetradeoxysugar, Micromonospora chalcea, TcaB9, C-3'-methyltransferase, Sugar methylation, TRANSFERASE
Deposited on 2010-06-07, released 2010-06-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-08-11, with a file datestamp of 2010-08-06.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.197
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methyltransferase
    Species: Micromonospora chalcea [TaxId:1874]
    Gene: tcab9
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ndia_
  • Heterogens: SAM, ZN, TMP, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ndiA (A:)
    ghmshladvspptacrvcgggvqefldlgrqplsdrfrkpdelddeftyrlavgrcdsce
    mvqlteevprdlmfhevypyhssgssvmrehfamlardflateltgpdpfiveigcndgi
    mlrtiqeagvrhlgfepssgvaakarekgirvrtdffekataddvrrtegpanviyaant
    lchipyvqsvlegvdallapdgvfvfedpylgdivaktsfdqiydehfflfsatsvqgma
    qrcgfelvdvqrlpvhggevrytlarqgsrtpsaavaqllaaereqelsdmatlrafagn
    vvkirdeltallhrlraegrsvvgygataksatvtnfcgigpdlvhsvydttpdkqnrlt
    pgahipvrpasafsdpypdyallfawnhaeeimakeqefhqaggrwilyvpevhir
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ndiA (A:)
    ptacrvcgggvqefldlgrqplsdrfrkpdelddeftyrlavgrcdscemvqlteevprd
    lmfhevypyhssgssvmrehfamlardflateltgpdpfiveigcndgimlrtiqeagvr
    hlgfepssgvaakarekgirvrtdffekataddvrrtegpanviyaantlchipyvqsvl
    egvdallapdgvfvfedpylgdivaktsfdqiydehfflfsatsvqgmaqrcgfelvdvq
    rlpvhggevrytlarqgsrtpsaavaqllaaereqelsdmatlrafagnvvkirdeltal
    lhrlraegrsvvgygataksatvtnfcgigpdlvhsvydttpdkqnrltpgahipvrpas
    afsdpypdyallfawnhaeeimakeqefhqaggrwilyvpevhir