PDB entry 3ndh

View 3ndh on RCSB PDB site
Description: restriction endonuclease in complex with substrate dna
Deposited on 2010-06-07, released 2010-07-28
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: restriction endonuclease THAI
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: Ta0828
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HJY3 (Start-224)
      • expression tag (4-9)
  • Chain 'B':
    Compound: restriction endonuclease THAI
    Species: Thermoplasma acidophilum [TaxId:2303]
    Gene: Ta0828
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: DNA (5'-d(*g*gp*tp*ap*cp*gp*cp*gp*ap*tp*g)-3')
  • Chain 'D':
    Compound: DNA (5'-d(*c*cp*ap*tp*cp*gp*cp*gp*tp*ap*c)-3')
  • Heterogens: NA, CL, PGE, ACT, SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3ndhA (A:)
    mghhhhhhefnirdrmndhlkdlfrdrliidkvqrrlpymfqlaelessragkvgmevgs
    lreriisslliykfgeknvetdlpitepeidvklfgspisiktitgkepagvkliwtvda
    tkarqfletwhprfdlilvhinwsslggvyyipdyvqqrifdeigkdkyiklpkqgtnpr
    gveisnealkeimtdeetmsikiewkktnvqynafkrwvdlwseg
    

    Sequence, based on observed residues (ATOM records):
    >3ndhA (A:)
    hhhhefdhlkdlfrdrliidkvqrrlpymfqlaelessragkvgmevgslreriisslli
    ykfgeknvetdlpitepeidvklfgspisiktitgkepagvkliwtvdatkarqfletwh
    prfdlilvhinwsslggvyyipdyvqqrifdeigkdkyiklpkqgtnprgveisnealke
    imtdeetmsikiewkktnvqynafkrwvdlwseg
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3ndhB (B:)
    mghhhhhhefnirdrmndhlkdlfrdrliidkvqrrlpymfqlaelessragkvgmevgs
    lreriisslliykfgeknvetdlpitepeidvklfgspisiktitgkepagvkliwtvda
    tkarqfletwhprfdlilvhinwsslggvyyipdyvqqrifdeigkdkyiklpkqgtnpr
    gveisnealkeimtdeetmsikiewkktnvqynafkrwvdlwseg
    

    Sequence, based on observed residues (ATOM records):
    >3ndhB (B:)
    dhlkdlfrdrliidkvqrrlpymfqlaelessragkvgmevgslreriisslliykfgek
    nvetdlpitepeidvklfgspisiktitgkepagvkliwtvdatkarqfletwhprfdli
    lvhinwsslggvyyipdyvqqrifdeigkdkyiklpkqgtnprgveisnealkeimtdee
    tmsikiewkktnvqynafkrwvdlwseg
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.