PDB entry 3ndf

View 3ndf on RCSB PDB site
Description: cleaved antitrypsin with p8-p6 asp
Deposited on 2010-06-07, released 2010-07-28
The last revision was dated 2017-06-28, with a file datestamp of 2017-06-23.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-1-antitrypsin
    Species: Homo sapiens [TaxId:9606]
    Gene: SERPINA1, AAT, PI, PRO0684, PRO2209
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01009 (Start-342)
      • engineered mutation (216)
      • engineered mutation (335-337)
      • engineered mutation (342)
  • Chain 'B':
    Compound: alpha-1-antitrypsin
    Species: Homo sapiens [TaxId:9606]
    Gene: SERPINA1, AAT, PI, PRO0684, PRO2209
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3ndfA (A:)
    gshmletfnkitpnlaefafslyrqlahqsnstniffspvsiatafamlslgtkadthde
    ileglnfnlteipeaqihegfqellrtlnqpdsqlqlttgnglflseglklvdkfledvk
    klyhseaftvnfgdteeakkqindyvekgtqgkivdlvkeldrdtvfalvnyiffkgkwe
    rpfevkdteeedfhvdqvttvkvpmmkrlgmfniqhakklsswvllmkylgnataifflp
    degklqhlenelthdiitkflenedrrsaslhlpklsitgtydlksvlgqlgitkvfsng
    adlsgvteeaplklskavhkavltidekgteaagadddeaipr
    

    Sequence, based on observed residues (ATOM records):
    >3ndfA (A:)
    fnkitpnlaefafslyrqlahqsnstniffspvsiatafamlslgtkadthdeileglnf
    nlteipeaqihegfqellrtlnqpdsqlqlttgnglflseglklvdkfledvkklyhsea
    ftvnfgdteeakkqindyvekgtqgkivdlvkeldrdtvfalvnyiffkgkwerpfevkd
    teeedfhvdqvttvkvpmmkrlgmfniqhakklsswvllmkylgnataifflpdegklqh
    lenelthdiitkflenedrrsaslhlpklsitgtydlksvlgqlgitkvfsngadlsgvt
    eeaplklskavhkavltidekgteaagadddeaipr
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3ndfB (B:)
    sippevkfnkpfvflmieqntksplfmgkvvnptqk
    

    Sequence, based on observed residues (ATOM records):
    >3ndfB (B:)
    ppevkfnkpfvflmieqntksplfmgkvvnptqk