PDB entry 3ndc

View 3ndc on RCSB PDB site
Description: Crystal structure of Precorrin-4 C11-methyltransferase from Rhodobacter capsulatus
Class: transferase
Keywords: methyltransferase, SAH, TRANSFERASE
Deposited on 2010-06-07, released 2011-06-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-06-15, with a file datestamp of 2011-06-10.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.189
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Precorrin-4 C(11)-methyltransferase
    Species: Rhodobacter capsulatus [TaxId:272942]
    Gene: cobM
    Database cross-references and differences (RAF-indexed):
    • Uniprot O68100 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d3ndca1, d3ndca2
  • Chain 'B':
    Compound: Precorrin-4 C(11)-methyltransferase
    Species: Rhodobacter capsulatus [TaxId:272942]
    Gene: cobM
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ndcb_
  • Heterogens: SAH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ndcA (A:)
    gshmtvhfigagpgaadlitirgrdliascpvclyagslvpeallahcppgakivntapm
    sldaiidtiaeahaagqdvarlhsgdlsiwsamgeqlrrlralnipydvtpgvpsfaaaa
    atlgaeltlpgvaqsviltrtsgrasampagetlenfartgavlaihlsvhvldevvqkl
    vphygedcpvaivwraswpdqrvvratlatlqtslgaelertalilvgrslatedfdesr
    lyagdydrryrplgthprfpegse
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ndcA (A:)
    gshmtvhfigagpgaadlitirgrdliascpvclyagslvpeallahcppgakivntapm
    sldaiidtiaeahaagqdvarlhsgdlsiwsamgeqlrrlralnipydvtpgvpsfaaaa
    atlgaeltlpgvaqsviltrtsgrasampagetlenfartgavlaihlsvhvldevvqkl
    vphygedcpvaivwraswpdqrvvratlatlqtslgaelertalilvgrslatedf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ndcB (B:)
    gshmtvhfigagpgaadlitirgrdliascpvclyagslvpeallahcppgakivntapm
    sldaiidtiaeahaagqdvarlhsgdlsiwsamgeqlrrlralnipydvtpgvpsfaaaa
    atlgaeltlpgvaqsviltrtsgrasampagetlenfartgavlaihlsvhvldevvqkl
    vphygedcpvaivwraswpdqrvvratlatlqtslgaelertalilvgrslatedfdesr
    lyagdydrryrplgthprfpegse
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ndcB (B:)
    mtvhfigagpgaadlitirgrdliascpvclyagslvpeallahcppgakivntapmsld
    aiidtiaeahaagqdvarlhsgdlsiwsamgeqlrrlralnipydvtpgvpsfaaaaatl
    gaeltlpgvaqsviltrtsgrasampagetlenfartgavlaihlsvhvldevvqklvph
    ygedcpvaivwraswpdqrvvratlatlqtlertalilvgrslatedfdes