PDB entry 3nda

View 3nda on RCSB PDB site
Description: Crystal structure of serpin from tick Ixodes ricinus
Class: hydrolase inhibitor
Keywords: serpin, vaccination target, tick, HYDROLASE INHIBITOR
Deposited on 2010-06-07, released 2010-10-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-09-11, with a file datestamp of 2013-09-06.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.173
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serpin-2
    Species: Ixodes ricinus [TaxId:34613]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q06B74 (1-376)
      • initiating methionine (0)
      • conflict (38)
      • conflict (252)
      • conflict (307-308)
    Domains in SCOPe 2.07: d3ndaa_
  • Chain 'B':
    Compound: Serpin-2
    Species: Ixodes ricinus [TaxId:34613]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q06B74 (1-376)
      • initiating methionine (0)
      • conflict (38)
      • conflict (252)
      • conflict (307-308)
    Domains in SCOPe 2.07: d3ndab_
  • Heterogens: 1PE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ndaA (A:)
    mqeeakltkannrfglrllralpsgpeknvffspysvstamgmafagargqtqqelsqgl
    gfsdvdltdagvldaythhterlkstpsnstldvanaaaiqrtlallnsyesalqssfga
    elhkvdfagepqaavdfvnnwvkrkthdkieklfnepldpdtllvllnaiyfkgewntaf
    vkehtekrqffnggvtpvevdtmrlearikyrffddlqvevvelpyrgldytmaillpke
    ntgveglkqnltidrfqnylsdlrerkitvllpkfkletkyslkaplqslgikqifesga
    dlsgindgslrvsavehkavvevneegtvaaattgvvivpyslgpepvvfrvdhpflffi
    rntrtddiffvgqvnkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ndaA (A:)
    mqeeakltkannrfglrllralpsgpeknvffspysvstamgmafagargqtqqelsqgl
    gfsdvdltdagvldaythhterlkstpsnstldvanaaaiqrtlallnsyesalqssfga
    elhkvdfagepqaavdfvnnwvkrkthdkieklfnepldpdtllvllnaiyfkgewntaf
    vkehtekrqffnggvtpvevdtmrlearikyrffddlqvevvelpyrgldytmaillpke
    ntgveglkqnltidrfqnylsdlrerkitvllpkfkletkyslkaplqslgikqifesga
    dlsgindgslrvsavehkavvevneegtvaaattgvvivpypepvvfrvdhpflffirnt
    rtddiffvgqvnkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ndaB (B:)
    mqeeakltkannrfglrllralpsgpeknvffspysvstamgmafagargqtqqelsqgl
    gfsdvdltdagvldaythhterlkstpsnstldvanaaaiqrtlallnsyesalqssfga
    elhkvdfagepqaavdfvnnwvkrkthdkieklfnepldpdtllvllnaiyfkgewntaf
    vkehtekrqffnggvtpvevdtmrlearikyrffddlqvevvelpyrgldytmaillpke
    ntgveglkqnltidrfqnylsdlrerkitvllpkfkletkyslkaplqslgikqifesga
    dlsgindgslrvsavehkavvevneegtvaaattgvvivpyslgpepvvfrvdhpflffi
    rntrtddiffvgqvnkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ndaB (B:)
    mqeeakltkannrfglrllralpsgpeknvffspysvstamgmafagargqtqqelsqgl
    gfsdvdltdagvldaythhterlkstpsnstldvanaaaiqrtlallnsyesalqssfga
    elhkvdfagepqaavdfvnnwvkrkthdkieklfnepldpdtllvllnaiyfkgewntaf
    vkehtekrqffnggvtpvevdtmrlearikyrffddlqvevvelpyrgldytmaillpke
    ntgveglkqnltidrfqnylsdlrerkitvllpkfkletkyslkaplqslgikqifesga
    dlsgindgslrvsavehkavvevneegtvaaattgvvivpypvvfrvdhpflffirntrt
    ddiffvgqvnkl