PDB entry 3nd9

View 3nd9 on RCSB PDB site
Description: structural characterization for the nucleotide binding ability of subunit a of the a1ao atp synthase
Deposited on 2010-06-07, released 2011-03-30
The last revision was dated 2017-08-23, with a file datestamp of 2017-08-18.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: V-type ATP synthase alpha chain
    Species: Pyrococcus horikoshii [TaxId:53953]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O57728 (Start-239)
      • engineered mutation (78)
    • Uniprot O57728 (240-587)
      • engineered mutation (240)
  • Heterogens: MRD, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nd9A (A:)
    mvakgriirvtgplvvadgmkgakmyevvrvgelgligeiirlegdkaviqvyeetagvr
    pgepvvgtgaslsvelgprlltsiydgiqrplevirektgdfiargvtapalprdkkwhf
    ipkakvgdkvvggdiigevpetsiivhkimvppgiegeiveiaeegdytieeviakvktp
    sgeikelkmyqrwpvrvkrpykeklppevplitgqrvidtffpqakggtaaipgpfgsgk
    avtqhqlakwsdaqvviyigcgergnemtdvleefpklkdpktgkplmertvliantsnm
    pvaareasiytgitiaeyfrdmgydvalmadstsrwaealreisgrleempgeegypayl
    asklaefyeragrvvtlgsdyrvgsvsvigavsppggdfsepvvqntlrvvkvfwaldad
    larrrhfpainwltsyslyvdavkdwwhknidpewkamrdkamallqkeselqeivrivg
    pdalpereraillvarmlredylqqdafdevdtycppekqvtmmrvllnfydktmeainr
    gvpleeiaklpvreeigrmkferdvskirslidktneqfeelfkkyga
    

    Sequence, based on observed residues (ATOM records):
    >3nd9A (A:)
    epvvgtgaslsvelgprlltsiydgiqrplevirektgdfiargvtapalprdkkwhfip
    kakvgdkvvggdiigevpetsiivhkimvppgiegeiveiaeegdytieeviakvktpsg
    eikelkmyqrwpvrvkrpykeklppevplitgqrvidtffpqakggtaaipgpfgsgkav
    tqhqlakwsdaqvviyigcgergnemtdvleefpklkdpktgkplmertvliantsnmpv
    aareasiytgitiaeyfrdmgydvalmadstsrwaepaylasklaefyeragrvvtlgsd
    yrvgsvsvigavsppggdfsepvvqntlrvvkvfwaldadlarrrhfpainwltsyslyv
    davkdwwhknidpewkamrdkamallqkeselqeivrivgpdalpereraillvarmlre
    dylqqdafdevdtycppekqvtmmrvllnfydktmeainrgvpleeiaklpvreeigrmk
    ferdvskirslidktneqfeelfkkyga