PDB entry 3nd7

View 3nd7 on RCSB PDB site
Description: Crystal structure of phosphopantetheine adenylyltransferase from Enterococcus faecalis in the ligand-unbound state and in complex with ATP and pantetheine
Class: transferase
Keywords: Phosphopantetheine adenylyltransferase, PPAT, Coenzyme A biosynthetic pathway, TRANSFERASE
Deposited on 2010-06-07, released 2011-06-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-12-14, with a file datestamp of 2011-12-09.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.217
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphopantetheine adenylyltransferase
    Species: Enterococcus faecalis [TaxId:1351]
    Gene: coaD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3nd7a_
  • Chain 'B':
    Compound: phosphopantetheine adenylyltransferase
    Species: Enterococcus faecalis [TaxId:1351]
    Gene: coaD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3nd7b_
  • Chain 'C':
    Compound: phosphopantetheine adenylyltransferase
    Species: Enterococcus faecalis [TaxId:1351]
    Gene: coaD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3nd7c_
  • Chain 'D':
    Compound: phosphopantetheine adenylyltransferase
    Species: Enterococcus faecalis [TaxId:1351]
    Gene: coaD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3nd7d_
  • Chain 'E':
    Compound: phosphopantetheine adenylyltransferase
    Species: Enterococcus faecalis [TaxId:1351]
    Gene: coaD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3nd7e_
  • Chain 'F':
    Compound: phosphopantetheine adenylyltransferase
    Species: Enterococcus faecalis [TaxId:1351]
    Gene: coaD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3nd7f_
  • Heterogens: PNY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nd7A (A:)
    mrkialfpgsfdpmtnghlnliersaklfdeviigvfintskqtlftpeekkylieeatk
    empnvrvimqetqltvesakslganflirgirnvkdyeyekdiakmnqhlapeietvfll
    aeepyahvsssllkevlrfggdvsdylppniyhalkqkkndwslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nd7A (A:)
    mrkialfpgsfdpmtnghlnliersaklfdeviigvfilftpeekkylieeatkempnvr
    vimqetqltvesakslganflirgirnvkdyeyekdiakmnqhlapeietvfllaeepya
    hvsssllkevlrfggdvsdylppniyhalkqk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3nd7B (B:)
    mrkialfpgsfdpmtnghlnliersaklfdeviigvfintskqtlftpeekkylieeatk
    empnvrvimqetqltvesakslganflirgirnvkdyeyekdiakmnqhlapeietvfll
    aeepyahvsssllkevlrfggdvsdylppniyhalkqkkndwslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nd7B (B:)
    mrkialfpgsfdpmtnghlnliersaklfdeviigvfilftpeekkylieeatkempnvr
    vimqetqltvesakslganflirgirnvkdyeyekdiakmnqhlapeietvfllaeepya
    hvsssllkevlrfggdvsdylppniyhalkqk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3nd7C (C:)
    mrkialfpgsfdpmtnghlnliersaklfdeviigvfintskqtlftpeekkylieeatk
    empnvrvimqetqltvesakslganflirgirnvkdyeyekdiakmnqhlapeietvfll
    aeepyahvsssllkevlrfggdvsdylppniyhalkqkkndwslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nd7C (C:)
    mrkialfpgsfdpmtnghlnliersaklfdeviigvfilftpeekkylieeatkempnvr
    vimqetqltvesakslganflirgirnvkdyeyekdiakmnqhlapeietvfllaeepya
    hvsssllkevlrfggdvsdylppniyhalkqk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3nd7D (D:)
    mrkialfpgsfdpmtnghlnliersaklfdeviigvfintskqtlftpeekkylieeatk
    empnvrvimqetqltvesakslganflirgirnvkdyeyekdiakmnqhlapeietvfll
    aeepyahvsssllkevlrfggdvsdylppniyhalkqkkndwslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nd7D (D:)
    mrkialfpgsfdpmtnghlnliersaklfdeviigvfilftpeekkylieeatkempnvr
    vimqetqltvesakslganflirgirnvkdyeyekdiakmnqhlapeietvfllaeepya
    hvsssllkevlrfggdvsdylppniyhalkqk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3nd7E (E:)
    mrkialfpgsfdpmtnghlnliersaklfdeviigvfintskqtlftpeekkylieeatk
    empnvrvimqetqltvesakslganflirgirnvkdyeyekdiakmnqhlapeietvfll
    aeepyahvsssllkevlrfggdvsdylppniyhalkqkkndwslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nd7E (E:)
    mrkialfpgsfdpmtnghlnliersaklfdeviigvfilftpeekkylieeatkempnvr
    vimqetqltvesakslganflirgirnvkdyeyekdiakmnqhlapeietvfllaeepya
    hvsssllkevlrfggdvsdylppniyhalkqk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3nd7F (F:)
    mrkialfpgsfdpmtnghlnliersaklfdeviigvfintskqtlftpeekkylieeatk
    empnvrvimqetqltvesakslganflirgirnvkdyeyekdiakmnqhlapeietvfll
    aeepyahvsssllkevlrfggdvsdylppniyhalkqkkndwslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nd7F (F:)
    mrkialfpgsfdpmtnghlnliersaklfdeviigvfilftpeekkylieeatkempnvr
    vimqetqltvesakslganflirgirnvkdyeyekdiakmnqhlapeietvfllaeepya
    hvsssllkevlrfggdvsdylppniyhalkqk