PDB entry 3nd6

View 3nd6 on RCSB PDB site
Description: Crystal structure of phosphopantetheine adenylyltransferase (PPAT) in complex with ATP from Enterococcus faecalis
Class: transferase
Keywords: Phosphopantetheine adenylyltransferase, PPAT, Coenzyme A biosynthetic pathway, TRANSFERASE
Deposited on 2010-06-07, released 2011-06-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-12-14, with a file datestamp of 2011-12-09.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.206
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphopantetheine adenylyltransferase
    Species: Enterococcus faecalis [TaxId:1351]
    Gene: coaD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3nd6a_
  • Chain 'B':
    Compound: phosphopantetheine adenylyltransferase
    Species: Enterococcus faecalis [TaxId:1351]
    Gene: coaD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3nd6b_
  • Chain 'C':
    Compound: phosphopantetheine adenylyltransferase
    Species: Enterococcus faecalis [TaxId:1351]
    Gene: coaD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3nd6c_
  • Chain 'D':
    Compound: phosphopantetheine adenylyltransferase
    Species: Enterococcus faecalis [TaxId:1351]
    Gene: coaD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3nd6d_
  • Chain 'E':
    Compound: phosphopantetheine adenylyltransferase
    Species: Enterococcus faecalis [TaxId:1351]
    Gene: coaD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3nd6e_
  • Chain 'F':
    Compound: phosphopantetheine adenylyltransferase
    Species: Enterococcus faecalis [TaxId:1351]
    Gene: coaD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3nd6f_
  • Heterogens: ATP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nd6A (A:)
    mrkialfpgsfdpmtnghlnliersaklfdeviigvfintskqtlftpeekkylieeatk
    empnvrvimqetqltvesakslganflirgirnvkdyeyekdiakmnqhlapeietvfll
    aeepyahvsssllkevlrfggdvsdylppniyhalkqkkndwslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nd6A (A:)
    mrkialfpgsfdpmtnghlnliersaklfdeviigvfilftpeekkylieeatkempnvr
    vimqetqltvesakslganflirgirnvkdyeyekdiakmnqhlapeietvfllaeepya
    hvsssllkevlrfggdvsdylppniyhalkqk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3nd6B (B:)
    mrkialfpgsfdpmtnghlnliersaklfdeviigvfintskqtlftpeekkylieeatk
    empnvrvimqetqltvesakslganflirgirnvkdyeyekdiakmnqhlapeietvfll
    aeepyahvsssllkevlrfggdvsdylppniyhalkqkkndwslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nd6B (B:)
    mrkialfpgsfdpmtnghlnliersaklfdeviigvfilftpeekkylieeatkempnvr
    vimqetqltvesakslganflirgirnvkdyeyekdiakmnqhlapeietvfllaeepya
    hvsssllkevlrfggdvsdylppniyhalkqk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3nd6C (C:)
    mrkialfpgsfdpmtnghlnliersaklfdeviigvfintskqtlftpeekkylieeatk
    empnvrvimqetqltvesakslganflirgirnvkdyeyekdiakmnqhlapeietvfll
    aeepyahvsssllkevlrfggdvsdylppniyhalkqkkndwslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nd6C (C:)
    mrkialfpgsfdpmtnghlnliersaklfdeviigvfilftpeekkylieeatkempnvr
    vimqetqltvesakslganflirgirnvkdyeyekdiakmnqhlapeietvfllaeepya
    hvsssllkevlrfggdvsdylppniyhalkqk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3nd6D (D:)
    mrkialfpgsfdpmtnghlnliersaklfdeviigvfintskqtlftpeekkylieeatk
    empnvrvimqetqltvesakslganflirgirnvkdyeyekdiakmnqhlapeietvfll
    aeepyahvsssllkevlrfggdvsdylppniyhalkqkkndwslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nd6D (D:)
    mrkialfpgsfdpmtnghlnliersaklfdeviigvfilftpeekkylieeatkempnvr
    vimqetqltvesakslganflirgirnvkdyeyekdiakmnqhlapeietvfllaeepya
    hvsssllkevlrfggdvsdylppniyhalkqk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3nd6E (E:)
    mrkialfpgsfdpmtnghlnliersaklfdeviigvfintskqtlftpeekkylieeatk
    empnvrvimqetqltvesakslganflirgirnvkdyeyekdiakmnqhlapeietvfll
    aeepyahvsssllkevlrfggdvsdylppniyhalkqkkndwslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nd6E (E:)
    mrkialfpgsfdpmtnghlnliersaklfdeviigvfilftpeekkylieeatkempnvr
    vimqetqltvesakslganflirgirnvkdyeyekdiakmnqhlapeietvfllaeepya
    hvsssllkevlrfggdvsdylppniyhalkqk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3nd6F (F:)
    mrkialfpgsfdpmtnghlnliersaklfdeviigvfintskqtlftpeekkylieeatk
    empnvrvimqetqltvesakslganflirgirnvkdyeyekdiakmnqhlapeietvfll
    aeepyahvsssllkevlrfggdvsdylppniyhalkqkkndwslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nd6F (F:)
    mrkialfpgsfdpmtnghlnliersaklfdeviigvfilftpeekkylieeatkempnvr
    vimqetqltvesakslganflirgirnvkdyeyekdiakmnqhlapeietvfllaeepya
    hvsssllkevlrfggdvsdylppniyhalkqk