PDB entry 3nd5

View 3nd5 on RCSB PDB site
Description: Crystal structure of phosphopantetheine adenylyltransferase (PPAT) from Enterococcus faecalis
Class: transferase
Keywords: Phosphopantetheine adenylyltransferase, PPAT, Coenzyme A biosynthetic pathway, TRANSFERASE
Deposited on 2010-06-07, released 2011-06-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-12-14, with a file datestamp of 2011-12-09.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.196
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphopantetheine adenylyltransferase
    Species: Enterococcus faecalis [TaxId:1351]
    Gene: coaD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nd5a_
  • Chain 'B':
    Compound: phosphopantetheine adenylyltransferase
    Species: Enterococcus faecalis [TaxId:1351]
    Gene: coaD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nd5b_
  • Chain 'C':
    Compound: phosphopantetheine adenylyltransferase
    Species: Enterococcus faecalis [TaxId:1351]
    Gene: coaD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nd5c_
  • Chain 'D':
    Compound: phosphopantetheine adenylyltransferase
    Species: Enterococcus faecalis [TaxId:1351]
    Gene: coaD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nd5d_
  • Chain 'E':
    Compound: phosphopantetheine adenylyltransferase
    Species: Enterococcus faecalis [TaxId:1351]
    Gene: coaD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nd5e_
  • Chain 'F':
    Compound: phosphopantetheine adenylyltransferase
    Species: Enterococcus faecalis [TaxId:1351]
    Gene: coaD
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nd5f_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nd5A (A:)
    mrkialfpgsfdpmtnghlnliersaklfdeviigvfintskqtlftpeekkylieeatk
    empnvrvimqetqltvesakslganflirgirnvkdyeyekdiakmnqhlapeietvfll
    aeepyahvsssllkevlrfggdvsdylppniyhalkqkkndwslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nd5A (A:)
    mrkialfpgsfdpmtnghlnliersaklfdeviigvfilftpeekkylieeatkempnvr
    vimqetqltvesakslganflirgirnvkdyeyekdiakmnqhlapeietvfllaeepya
    hvsssllkevlrfggdvsdylppniyhalkqk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3nd5B (B:)
    mrkialfpgsfdpmtnghlnliersaklfdeviigvfintskqtlftpeekkylieeatk
    empnvrvimqetqltvesakslganflirgirnvkdyeyekdiakmnqhlapeietvfll
    aeepyahvsssllkevlrfggdvsdylppniyhalkqkkndwslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nd5B (B:)
    mrkialfpgsfdpmtnghlnliersaklfdeviigvfilftpeekkylieeatkempnvr
    vimqetqltvesakslganflirgirnvkdyeyekdiakmnqhlapeietvfllaeepya
    hvsssllkevlrfggdvsdylppniyhalkqk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3nd5C (C:)
    mrkialfpgsfdpmtnghlnliersaklfdeviigvfintskqtlftpeekkylieeatk
    empnvrvimqetqltvesakslganflirgirnvkdyeyekdiakmnqhlapeietvfll
    aeepyahvsssllkevlrfggdvsdylppniyhalkqkkndwslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nd5C (C:)
    mrkialfpgsfdpmtnghlnliersaklfdeviigvfilftpeekkylieeatkempnvr
    vimqetqltvesakslganflirgirnvkdyeyekdiakmnqhlapeietvfllaeepya
    hvsssllkevlrfggdvsdylppniyhalkqk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3nd5D (D:)
    mrkialfpgsfdpmtnghlnliersaklfdeviigvfintskqtlftpeekkylieeatk
    empnvrvimqetqltvesakslganflirgirnvkdyeyekdiakmnqhlapeietvfll
    aeepyahvsssllkevlrfggdvsdylppniyhalkqkkndwslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nd5D (D:)
    mrkialfpgsfdpmtnghlnliersaklfdeviigvfilftpeekkylieeatkempnvr
    vimqetqltvesakslganflirgirnvkdyeyekdiakmnqhlapeietvfllaeepya
    hvsssllkevlrfggdvsdylppniyhalkqk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3nd5E (E:)
    mrkialfpgsfdpmtnghlnliersaklfdeviigvfintskqtlftpeekkylieeatk
    empnvrvimqetqltvesakslganflirgirnvkdyeyekdiakmnqhlapeietvfll
    aeepyahvsssllkevlrfggdvsdylppniyhalkqkkndwslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nd5E (E:)
    mrkialfpgsfdpmtnghlnliersaklfdeviigvfilftpeekkylieeatkempnvr
    vimqetqltvesakslganflirgirnvkdyeyekdiakmnqhlapeietvfllaeepya
    hvsssllkevlrfggdvsdylppniyhalkqk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3nd5F (F:)
    mrkialfpgsfdpmtnghlnliersaklfdeviigvfintskqtlftpeekkylieeatk
    empnvrvimqetqltvesakslganflirgirnvkdyeyekdiakmnqhlapeietvfll
    aeepyahvsssllkevlrfggdvsdylppniyhalkqkkndwslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nd5F (F:)
    mrkialfpgsfdpmtnghlnliersaklfdeviigvfilftpeekkylieeatkempnvr
    vimqetqltvesakslganflirgirnvkdyeyekdiakmnqhlapeietvfllaeepya
    hvsssllkevlrfggdvsdylppniyhalkqk