PDB entry 3nd0

View 3nd0 on RCSB PDB site
Description: X-ray crystal structure of a slow cyanobacterial Cl-/H+ antiporter
Deposited on 2010-06-06, released 2011-01-19
The last revision was dated 2011-02-16, with a file datestamp of 2011-02-11.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.244
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sll0855 protein
    Species: Synechocystis [TaxId:1148]
    Gene: sll0855
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Sll0855 protein
    Species: Synechocystis [TaxId:1148]
    Gene: sll0855
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CL

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nd0A (A:)
    maadfetsnrrwldklprnltdsarslhprtlvaaivvglitgvlgagfksavnnmlqwr
    sqlaqilapipplawlvtalisggmvalsfwlmkrfapdtsgsgipqieghlegklplvw
    qrvlpiklvggflslgagmlagfegptiqmggsigqmtggwfkatqenqriliavgagag
    latafnaplagvaligeemhprfrsqtlayhsllfgcvmatiilrmirgqsaiisltefk
    rvpldslwmfiilgilfgvmgytfnrglfkvldwfdrlpplatkwkgfllgsiigilslf
    plpltdggdnavlwafnsqshfstlilvfcgrflltlicygsgaiggifapmlgiasivs
    vamarhfhllfpsqipepavmaiagmgalvaatvrapltailltiemtdnyfvilpllvt
    clvasvvaealggkpiytvllertlakqnrgslvprgsgghhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3nd0A (A:)
    slhprtlvaaivvglitgvlgagfksavnnmlqwrsqlaqilapipplawlvtalisggm
    valsfwlmkrfapdtsgsgipqieghlegklplvwqrvlpiklvggflslgagmlagfeg
    ptiqmggsigqmtggwfkatqenqriliavgagaglatafnaplagvaligeemhprfrs
    qtlayhsllfgcvmatiilrmirgqsaiisltefkrvpldslwmfiilgilfgvmgytfn
    rglfkvldwfdrlpplatkwkgfllgsiigilslfplpltdggdnavlwafnsqshfstl
    ilvfcgrflltlicygsgaiggifapmlgiasivsvamarhfhllfpsqipepavmaiag
    mgalvaatvrapltailltiemtdnyfvilpllvtclvasvvaealggkpiytvllertl
    akqnr
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nd0B (B:)
    maadfetsnrrwldklprnltdsarslhprtlvaaivvglitgvlgagfksavnnmlqwr
    sqlaqilapipplawlvtalisggmvalsfwlmkrfapdtsgsgipqieghlegklplvw
    qrvlpiklvggflslgagmlagfegptiqmggsigqmtggwfkatqenqriliavgagag
    latafnaplagvaligeemhprfrsqtlayhsllfgcvmatiilrmirgqsaiisltefk
    rvpldslwmfiilgilfgvmgytfnrglfkvldwfdrlpplatkwkgfllgsiigilslf
    plpltdggdnavlwafnsqshfstlilvfcgrflltlicygsgaiggifapmlgiasivs
    vamarhfhllfpsqipepavmaiagmgalvaatvrapltailltiemtdnyfvilpllvt
    clvasvvaealggkpiytvllertlakqnrgslvprgsgghhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3nd0B (B:)
    slhprtlvaaivvglitgvlgagfksavnnmlqwrsqlaqilapipplawlvtalisggm
    valsfwlmkrfapdtsgsgipqieghlegklplvwqrvlpiklvggflslgagmlagfeg
    ptiqmggsigqmtggwfkatqenqriliavgagaglatafnaplagvaligeemhprfrs
    qtlayhsllfgcvmatiilrmirgqsaiisltefkrvpldslwmfiilgilfgvmgytfn
    rglfkvldwfdrlpplatkwkgfllgsiigilslfplpltdggdnavlwafnsqshfstl
    ilvfcgrflltlicygsgaiggifapmlgiasivsvamarhfhllfpsqipepavmaiag
    mgalvaatvrapltailltiemtdnyfvilpllvtclvasvvaealggkpiytvllertl
    akqnr