PDB entry 3ncy

View 3ncy on RCSB PDB site
Description: X-ray crystal structure of an arginine agmatine antiporter (AdiC) in complex with a Fab fragment
Deposited on 2010-06-06, released 2010-08-18
The last revision was dated 2010-08-18, with a file datestamp of 2010-08-13.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.283
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: AdiC
    Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:90371]
    Gene: ADIC_SALTY
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: AdiC
    Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:90371]
    Gene: ADIC_SALTY
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: AdiC
    Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:90371]
    Gene: ADIC_SALTY
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: AdiC
    Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:90371]
    Gene: ADIC_SALTY
    Database cross-references and differences (RAF-indexed):
  • Chain 'P':
    Compound: Fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3NCY (0-218)
  • Chain 'Q':
    Compound: Fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3NCY (0-End)
  • Chain 'S':
    Compound: Fab light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3NCY (0-210)
  • Chain 'W':
    Compound: Fab light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3NCY (0-210)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3ncyA (A:)
    mssdadahkvglipvtlmvsgnimgsgvfllpanlaatggiaiygwlvtiigalalsmvy
    akmssldpspggsyayarrcfgpflgyqtnvlywlacwigniamvvigvgylsyffpilk
    dplvltltcvavlwifvllnivgpkmitrvqavatvlalvpivgiavfgwfwfkgetyma
    awnvsgmntfgaiqstlnvtlwsfigvesasvaagvvknpkrnvpiatiggvliaavcyv
    lsttaimgmipnaalrvsaspfgdaarmalgdtagaivsfcaaagclgslggwtllagqt
    akaaaddglfppifarvnkagtpvagllivgvlmtifqfssmspnaakefglvssvsvif
    tlvpylytcaallllghghfgkarplyllitfvafvyciwavigsgakevmwsfvtlmvi
    talyalnynrihknpypldapvkqd
    

    Sequence, based on observed residues (ATOM records):
    >3ncyA (A:)
    vglipvtlmvsgnimgsgvfllpanlaatggiaiygwlvtiigalalsmvyakmssldps
    pggsyayarrcfgpflgyqtnvlywlacwigniamvvigvgylsyffpilkdplvltltc
    vavlwifvllnivgpkmitrvqavatvlalvpivgiavfgwfwfkgewnvsgmntfgaiq
    stlnvtlwsfigvesasvaagvvknpkrnvpiatiggvliaavcyvlsttaimgmipnaa
    lrvsaspfgdaarmalgdtagaivsfcaaagclgslggwtllagqtakaaaddglfppif
    artpvagllivgvlmtifqfssmspnaakefglvssvsviftlvpylytcaallllghgh
    fgkarplyllitfvafvyciwavigsgakevmwsfvtlmvitalyalnynrihknpypld
    ap
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3ncyB (B:)
    mssdadahkvglipvtlmvsgnimgsgvfllpanlaatggiaiygwlvtiigalalsmvy
    akmssldpspggsyayarrcfgpflgyqtnvlywlacwigniamvvigvgylsyffpilk
    dplvltltcvavlwifvllnivgpkmitrvqavatvlalvpivgiavfgwfwfkgetyma
    awnvsgmntfgaiqstlnvtlwsfigvesasvaagvvknpkrnvpiatiggvliaavcyv
    lsttaimgmipnaalrvsaspfgdaarmalgdtagaivsfcaaagclgslggwtllagqt
    akaaaddglfppifarvnkagtpvagllivgvlmtifqfssmspnaakefglvssvsvif
    tlvpylytcaallllghghfgkarplyllitfvafvyciwavigsgakevmwsfvtlmvi
    talyalnynrihknpypldapvkqd
    

    Sequence, based on observed residues (ATOM records):
    >3ncyB (B:)
    vglipvtlmvsgnimgsgvfllpanlaatggiaiygwlvtiigalalsmvyakmssldps
    pggsyayarrcfgpflgyqtnvlywlacwigniamvvigvgylsyffpilkdplvltltc
    vavlwifvllnivgpkmitrvqavatvlalvpivgiavfgwfwfkwnvsgmntfgaiqst
    lnvtlwsfigvesasvaagvvknpkrnvpiatiggvliaavcyvlsttaimgmipnaalr
    vsaspfgdaarmalgdtagaivsfcaaagclgslggwtllagqtakaaaddglfppifar
    vnkaggllivgvlmtifqfssmspnaakefglvssvsviftlvpylytcaallllghghf
    gkarplyllitfvafvyciwavigsgakevmwsfvtlmvitalyalnynrihknpyplda
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3ncyC (C:)
    mssdadahkvglipvtlmvsgnimgsgvfllpanlaatggiaiygwlvtiigalalsmvy
    akmssldpspggsyayarrcfgpflgyqtnvlywlacwigniamvvigvgylsyffpilk
    dplvltltcvavlwifvllnivgpkmitrvqavatvlalvpivgiavfgwfwfkgetyma
    awnvsgmntfgaiqstlnvtlwsfigvesasvaagvvknpkrnvpiatiggvliaavcyv
    lsttaimgmipnaalrvsaspfgdaarmalgdtagaivsfcaaagclgslggwtllagqt
    akaaaddglfppifarvnkagtpvagllivgvlmtifqfssmspnaakefglvssvsvif
    tlvpylytcaallllghghfgkarplyllitfvafvyciwavigsgakevmwsfvtlmvi
    talyalnynrihknpypldapvkqd
    

    Sequence, based on observed residues (ATOM records):
    >3ncyC (C:)
    glipvtlmvsgnimgsgvfllpanlaatggiaiygwlvtiigalalsmvyakmssldpsp
    ggsyayarrcfgpflgyqtnvlywlacwigniamvvigvgylsyffpilkdplvltltcv
    avlwifvllnivgpkmitrvqavatvlalvpivgiavfgwfwfkwnvsgmntfgaiqstl
    nvtlwsfigvesasvaagvvknpkrnvpiatiggvliaavcyvlsttaimgmipnaalrv
    saspfgdaarmalgdtagaivsfcaaagclgslggwtllagqtakaaaddglfppifarg
    tpvagllivgvlmtifqfssmspnaakefglvssvsviftlvpylytcaallllghghfg
    karplyllitfvafvyciwavigsgakevmwsfvtlmvitalyalnynrihknpypldap
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3ncyD (D:)
    mssdadahkvglipvtlmvsgnimgsgvfllpanlaatggiaiygwlvtiigalalsmvy
    akmssldpspggsyayarrcfgpflgyqtnvlywlacwigniamvvigvgylsyffpilk
    dplvltltcvavlwifvllnivgpkmitrvqavatvlalvpivgiavfgwfwfkgetyma
    awnvsgmntfgaiqstlnvtlwsfigvesasvaagvvknpkrnvpiatiggvliaavcyv
    lsttaimgmipnaalrvsaspfgdaarmalgdtagaivsfcaaagclgslggwtllagqt
    akaaaddglfppifarvnkagtpvagllivgvlmtifqfssmspnaakefglvssvsvif
    tlvpylytcaallllghghfgkarplyllitfvafvyciwavigsgakevmwsfvtlmvi
    talyalnynrihknpypldapvkqd
    

    Sequence, based on observed residues (ATOM records):
    >3ncyD (D:)
    vglipvtlmvsgnimgsgvfllpanlaatggiaiygwlvtiigalalsmvyakmssldps
    pggsyayarrcfgpflgyqtnvlywlacwigniamvvigvgylsyffpilkdplvltltc
    vavlwifvllnivgpkmitrvqavatvlalvpivgiavfgwfwfkwnvsgmntfgaiqst
    lnvtlwsfigvesasvaagvvknpkrnvpiatiggvliaavcyvlsttaimgmipnaalr
    vsaspfgdaarmalgdtagaivsfcaaagclgslggwtllagqtakaaaddglfppifar
    gtpvagllivgvlmtifqfssmspnaakefglvssvsviftlvpylytcaallllghghf
    gkarplyllitfvafvyciwavigsgakevmwsfvtlmvitalyalnynrihknpypld
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records:
    >3ncyP (P:)
    qvqlqqsgpelvkpgalvkisckasgytftnydinwvkqrpgqglewigwiypgdgstmy
    nekfkgkatltadkssstaymqlssltsenssvyfcarldgnyggwfaywgqgtsvtvss
    akttppsvyplapvcgdttgssvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
    lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivp
    

  • Chain 'Q':
    Sequence, based on SEQRES records:
    >3ncyQ (Q:)
    qvqlqqsgpelvkpgalvkisckasgytftnydinwvkqrpgqglewigwiypgdgstmy
    nekfkgkatltadkssstaymqlssltsenssvyfcarldgnyggwfaywgqgtsvtvss
    akttppsvyplapvcgdttgssvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
    lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivp
    

    Sequence, based on observed residues (ATOM records):
    >3ncyQ (Q:)
    qvqlqqsgpelvkpgalvkisckasgytftnydinwvkqrpgqglewigwiypgdgstmy
    nekfkgkatltadkssstaymqlssltsenssvyfcarldgnyggwfaywgqgtsvtvss
    akttppsvyplapvcgdttgssvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
    lytlsssvtvpsstwpsetvtcnvahpasstkvdkkiv
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records:
    >3ncyS (S:)
    elvmtqspaimsaspgekvtmtcsasssvnymhwyqqksgtspkrwiydtsklasgvpar
    fsgsgsgtsysltissmeaedaatyycqqwsynpptfgggtkleikradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnr
    

  • Chain 'W':
    Sequence; same for both SEQRES and ATOM records:
    >3ncyW (W:)
    elvmtqspaimsaspgekvtmtcsasssvnymhwyqqksgtspkrwiydtsklasgvpar
    fsgsgsgtsysltissmeaedaatyycqqwsynpptfgggtkleikradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnr