PDB entry 3ncx

View 3ncx on RCSB PDB site
Description: Crystal structure of EHEC O157:H7 intimin mutant
Class: Cell Adhesion
Keywords: intimin tir, Cell Adhesion
Deposited on 2010-06-06, released 2011-01-05
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-01-12, with a file datestamp of 2011-01-07.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.216
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Intimin adherence protein
    Species: Escherichia coli O157:H7 [TaxId:544404]
    Database cross-references and differences (RAF-indexed):
    • Uniprot C6UYL6 (1-188)
      • engineered mutation (170)
  • Chain 'B':
    Compound: Intimin adherence protein
    Species: Escherichia coli O157:H7 [TaxId:544404]
    Database cross-references and differences (RAF-indexed):
    • Uniprot C6UYL6 (Start-188)
      • engineered mutation (170)
    Domains in SCOPe 2.03: d3ncxb1, d3ncxb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ncxB (B:)
    matevtffdelkidnkvdiignnvrgelpniwlqygqfklkasggdgtyswysentsiat
    vdasgkvtlngkgsvvikatsgdkqtvsytikapsymikvdkqayyadamsicknllpst
    qtvlsdiydswgaankyshyssmnsitawikqtsseqrsgvsstynlitqyplpgvnvnt
    pnvyavcve
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ncxB (B:)
    ffdelkidnkvdiignnvrgelpniwlqygqfklkasggdgtyswysentsiatvdasgk
    vtlngkgsvvikatsgdkqtvsytikapsymikvdkqayyadamsicknllpstqtvlsd
    iydswgaankyshyssmnsitawikqtsseqrsgvsstynlitqyplpgvnvntpnvyav
    cve