PDB entry 3ncw

View 3ncw on RCSB PDB site
Description: Crystal structure of EHEC O157:H7 intimin
Class: cell adhesion
Keywords: CELL MEMBRANE, cell adhesion, IMMUNOGLOBULIN-LIKE FOLD, C-TYPE and LECTIN-LIKE FOLD
Deposited on 2010-06-06, released 2011-01-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-01-12, with a file datestamp of 2011-01-07.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.254
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Intimin adherence protein
    Species: Escherichia coli O157:H7 [TaxId:544404]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ncwa1, d3ncwa2
  • Chain 'B':
    Compound: Intimin adherence protein
    Species: Escherichia coli O157:H7 [TaxId:544404]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ncwb1, d3ncwb2
  • Chain 'C':
    Compound: Intimin adherence protein
    Species: Escherichia coli O157:H7 [TaxId:544404]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ncwc1, d3ncwc2
  • Chain 'D':
    Compound: Intimin adherence protein
    Species: Escherichia coli O157:H7 [TaxId:544404]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ncwd1, d3ncwd2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ncwA (A:)
    matevtffdelkidnkvdiignnvrgelpniwlqygqfklkasggdgtyswysentsiat
    vdasgkvtlngkgsvvikatsgdkqtvsytikapsymikvdkqayyadamsicknllpst
    qtvlsdiydswgaankyshyssmnsitawikqtsseqrsgvsstynlitqnplpgvnvnt
    pnvyavcve
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ncwA (A:)
    ffdelkidnkvdiignnvrgelpniwlqygqfklkasggdgtyswysentsiatvdasgk
    vtlngkgsvvikatsgdkqtvsytikapsymikvdkqayyadamsicknllpstqtvlsd
    iydswgaankyshyssmnsitawikqtsseqrsgvsstynlitqnplpgvnvntpnvyav
    cve
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ncwB (B:)
    matevtffdelkidnkvdiignnvrgelpniwlqygqfklkasggdgtyswysentsiat
    vdasgkvtlngkgsvvikatsgdkqtvsytikapsymikvdkqayyadamsicknllpst
    qtvlsdiydswgaankyshyssmnsitawikqtsseqrsgvsstynlitqnplpgvnvnt
    pnvyavcve
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ncwB (B:)
    ffdelkidnkvdiignnvrgelpniwlqygqfklkasggdgtyswysentsiatvdasgk
    vtlngkgsvvikatsgdkqtvsytikapsymikvdkqayyadamsicknllpstqtvlsd
    iydswgaankyshyssmnsitawikqtsseqrsgvsstynlitqnplpgvnvntpnvyav
    cve
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3ncwC (C:)
    matevtffdelkidnkvdiignnvrgelpniwlqygqfklkasggdgtyswysentsiat
    vdasgkvtlngkgsvvikatsgdkqtvsytikapsymikvdkqayyadamsicknllpst
    qtvlsdiydswgaankyshyssmnsitawikqtsseqrsgvsstynlitqnplpgvnvnt
    pnvyavcve
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ncwC (C:)
    ffdelkidnkvdiignnvrgelpniwlqygqfklkasggdgtyswysentsiatvdasgk
    vtlngkgsvvikatsgdkqtvsytikapsymikvdkqayyadamsicknllpstqtvlsd
    iydswgaankyshyssmnsitawikqtsseqrsgvsstynlitqnplpgvnvntpnvyav
    cve
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3ncwD (D:)
    matevtffdelkidnkvdiignnvrgelpniwlqygqfklkasggdgtyswysentsiat
    vdasgkvtlngkgsvvikatsgdkqtvsytikapsymikvdkqayyadamsicknllpst
    qtvlsdiydswgaankyshyssmnsitawikqtsseqrsgvsstynlitqnplpgvnvnt
    pnvyavcve
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ncwD (D:)
    ffdelkidnkvdiignnvrgelpniwlqygqfklkasggdgtyswysentsiatvdasgk
    vtlngkgsvvikatsgdkqtvsytikapsymikvdkqayyadamsicknllpstqtvlsd
    iydswgaankyshyssmnsitawikqtsseqrsgvsstynlitqnplpgvnvntpnvyav
    cve