PDB entry 3ncv

View 3ncv on RCSB PDB site
Description: ngol
Deposited on 2010-06-05, released 2010-12-08
The last revision was dated 2010-12-08, with a file datestamp of 2010-12-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.221
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA mismatch repair protein mutL
    Species: Neisseria gonorrhoeae [TaxId:242231]
    Gene: mutL, NGO0744, NgoL
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: DNA mismatch repair protein mutL
    Species: Neisseria gonorrhoeae [TaxId:242231]
    Gene: mutL, NGO0744, NgoL
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3ncvA (A:)
    tmgsshhhhhhssglvprgshsqselpplgfaiaqllgiyilaqaedslllidmhaaaer
    vnyekmkrqrqengnlqsqhllipvtfaasheecaaladhaetlagfglelsdmggntla
    vraapvmlgksdvvslardvlgelaqvgssqtiashenrilatmschgsiragrrltlpe
    mnallrdmentprsnqcnhgrptwvkltlkeldtlflrgq
    

    Sequence, based on observed residues (ATOM records):
    >3ncvA (A:)
    elpplgfaiaqllgiyilaqaedslllidmhaaaervnyekmkrqrqengnlqsqhllip
    vtfaasheecaaladhaetlagfglelsdmggntlavraapvmlgksdvvslardvlgel
    aqvgashenrilatmschgsiragrrltlpemnallrdmentprsnqcnhgrptwvkltl
    keldtlf
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3ncvB (B:)
    tmgsshhhhhhssglvprgshsqselpplgfaiaqllgiyilaqaedslllidmhaaaer
    vnyekmkrqrqengnlqsqhllipvtfaasheecaaladhaetlagfglelsdmggntla
    vraapvmlgksdvvslardvlgelaqvgssqtiashenrilatmschgsiragrrltlpe
    mnallrdmentprsnqcnhgrptwvkltlkeldtlflrgq
    

    Sequence, based on observed residues (ATOM records):
    >3ncvB (B:)
    lpplgfaiaqllgiyilaqaedslllidmhaaaervnyekmkrqrqengnlqsqhllipv
    tfaasheecaaladhaetlagfglelsdmggntlavraapvmlgksdvvslardvlgela
    qvgashenrilatmschgsiragrrltlpemnallrdmentprsnqcnhgrptwvkltlk
    eldtlflr