PDB entry 3ncu

View 3ncu on RCSB PDB site
Description: Structural and functional insights into pattern recognition by the innate immune receptor RIG-I
Class: RNA binding protein/RNA
Keywords: innate immune receptor, RIG-I c-terminal domain, RNA BINDING PROTEIN-RNA complex
Deposited on 2010-06-05, released 2010-06-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-08-18, with a file datestamp of 2010-08-13.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.192
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rig-I
    Species: Homo sapiens [TaxId:9606]
    Gene: DDX58, RIG-I
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ncua_
  • Chain 'B':
    Compound: rig-I
    Species: Homo sapiens [TaxId:9606]
    Gene: DDX58, RIG-I
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ncub_
  • Chain 'C':
    Compound: 5'-r(*(GDP)p*ap*cp*gp*cp*up*ap*gp*cp*gp*up*c)-3'
  • Chain 'D':
    Compound: 5'-r(*(GDP)p*ap*cp*gp*cp*up*ap*gp*cp*gp*up*c)-3'
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ncuA (A:)
    dsqekpkpvpdkenkkllcrkckalacytadvrvieechytvlgdafkecfvsrphpkpk
    qfssfekrakifcarqncshdwgihvkyktfeipvikiesfvvediatgvqtlyskwkdf
    hfekipfdpaemsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ncuA (A:)
    enkkllcrkckalacytadvrvieechytvlgdafkecfvsrphpkpkqfssfekrakif
    carqncshdwgihvkyktfeipvikiesfvvediatgvqtlyskwkdfhfekipfdpaem
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ncuB (B:)
    dsqekpkpvpdkenkkllcrkckalacytadvrvieechytvlgdafkecfvsrphpkpk
    qfssfekrakifcarqncshdwgihvkyktfeipvikiesfvvediatgvqtlyskwkdf
    hfekipfdpaemsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ncuB (B:)
    enkkllcrkckalacytadvrvieechytvlgdafkecfvsrphpkpkqfssfekrakif
    carqncshdwgihvkyktfeipvikiesfvvediatgvqtlyskwkdfhfekipfdpaem
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.