PDB entry 3nct

View 3nct on RCSB PDB site
Description: X-ray crystal structure of the bacterial conjugation factor PsiB, a negative regulator of reca
Deposited on 2010-06-05, released 2010-07-21
The last revision was dated 2010-10-13, with a file datestamp of 2010-10-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.186
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein psiB
    Species: Escherichia coli [TaxId:562]
    Gene: ECOK12F063, psiB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10031
      • see remark 999 (136)
  • Chain 'B':
    Compound: Protein psiB
    Species: Escherichia coli [TaxId:562]
    Gene: ECOK12F063, psiB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10031
      • see remark 999 (136)
  • Chain 'C':
    Compound: Protein psiB
    Species: Escherichia coli [TaxId:562]
    Gene: ECOK12F063, psiB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10031
      • see remark 999 (136)
  • Chain 'D':
    Compound: Protein psiB
    Species: Escherichia coli [TaxId:562]
    Gene: ECOK12F063, psiB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10031
      • see remark 999 (136)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nctA (A:)
    mkteltlnvlqtmnaqeyediraagsderrelthavmreldapdnwtmngeygsefggff
    pvqvrftpaherfhlalcspgdvsqvwvlvlvnaggepfavvqvqrrfaseavshslala
    asldtqgysvndiihilmaeggqv
    

    Sequence, based on observed residues (ATOM records):
    >3nctA (A:)
    lnvlqtmnaqeyediraagsderrelthavmreldapdnwtmngeygsefggffpvqvrf
    tpaherfhlalcspgdvsqvwvlvlvnaggepfavvqvqrrfaseavshslalaasldtq
    gysvndiihilmaeggq
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nctB (B:)
    mkteltlnvlqtmnaqeyediraagsderrelthavmreldapdnwtmngeygsefggff
    pvqvrftpaherfhlalcspgdvsqvwvlvlvnaggepfavvqvqrrfaseavshslala
    asldtqgysvndiihilmaeggqv
    

    Sequence, based on observed residues (ATOM records):
    >3nctB (B:)
    ltlnvlqtmnaqeyediraagsderrelthavmreldapdnwtmngeygsefggffpvqv
    rftpaherfhlalcspgdvsqvwvlvlvnaggepfavvqvqrrfaseavshslalaasld
    tqgysvndiihilmaeggq
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3nctC (C:)
    mkteltlnvlqtmnaqeyediraagsderrelthavmreldapdnwtmngeygsefggff
    pvqvrftpaherfhlalcspgdvsqvwvlvlvnaggepfavvqvqrrfaseavshslala
    asldtqgysvndiihilmaeggqv
    

    Sequence, based on observed residues (ATOM records):
    >3nctC (C:)
    ltlnvlqtmnaqeyediraagsderrelthavmreldapdnwtmngeygsefggffpvqv
    rftpaherfhlalcspgdvsqvwvlvlvnaggepfavvqvqrrfaseavshslalaasld
    tqgysvndiihilmaeggq
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3nctD (D:)
    mkteltlnvlqtmnaqeyediraagsderrelthavmreldapdnwtmngeygsefggff
    pvqvrftpaherfhlalcspgdvsqvwvlvlvnaggepfavvqvqrrfaseavshslala
    asldtqgysvndiihilmaeggqv
    

    Sequence, based on observed residues (ATOM records):
    >3nctD (D:)
    eltlnvlqtmnaqeyediraagsderrelthavmreldapdnwtmngeygsefggffpvq
    vrftpaherfhlalcspgdvsqvwvlvlvnaggepfavvqvqrrfaseavshslalaasl
    dtqgysvndiihilmaeggq