PDB entry 3ncq

View 3ncq on RCSB PDB site
Description: GlnK2 from Archaeoglobus fulgidus, ATP complex
Class: signaling protein
Keywords: PII signaling, nucleotide binding, GlnK, GlnB, SIGNALING PROTEIN
Deposited on 2010-06-05, released 2010-07-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-01-19, with a file datestamp of 2011-01-14.
Experiment type: XRAY
Resolution: 1.24 Å
R-factor: 0.17
AEROSPACI score: 0.79 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nitrogen regulatory protein P-II (GlnB-2)
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF_1747, glnK2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ncqa_
  • Chain 'B':
    Compound: Nitrogen regulatory protein P-II (GlnB-2)
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF_1747, glnK2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ncqb_
  • Chain 'C':
    Compound: Nitrogen regulatory protein P-II (GlnB-2)
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: AF_1747, glnK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot O28527 (0-111)
      • expression tag (112-114)
    Domains in SCOPe 2.07: d3ncqc1, d3ncqc2
  • Heterogens: ATP, CL, ACT, MG, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ncqA (A:)
    mkkieaivraekfpevkaaleergfygmtvtdvkgrgqqggmqiqfrgrtmevtllpkvk
    leivvkddaveeviglivnsaftgspgdgkifiipvedvvrirtgergddslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ncqA (A:)
    mkkieaivraekfpevkaaleergfygmtvtdvkgrgqqggmqiqfrgrtmevtllpkvk
    leivvkddaveeviglivnsaftgspgdgkifiipvedvvrirtgergddsl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ncqB (B:)
    mkkieaivraekfpevkaaleergfygmtvtdvkgrgqqggmqiqfrgrtmevtllpkvk
    leivvkddaveeviglivnsaftgspgdgkifiipvedvvrirtgergddslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ncqB (B:)
    mkkieaivraekfpevkaaleergfygmtvtdvkgrgqqggmqiqfrgrtmevtllpkvk
    leivvkddaveeviglivnsaftgspgdgkifiipvedvvrirtgergddsl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3ncqC (C:)
    mkkieaivraekfpevkaaleergfygmtvtdvkgrgqqggmqiqfrgrtmevtllpkvk
    leivvkddaveeviglivnsaftgspgdgkifiipvedvvrirtgergddslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ncqC (C:)
    mkkieaivraekfpevkaaleergfygmtvtdvkgrgqqggmqiqfrgrtmevtllpkvk
    leivvkddaveeviglivnsaftgspgdgkifiipvedvvrirtgergddslehh