PDB entry 3nco

View 3nco on RCSB PDB site
Description: Crystal structure of FnCel5A from F. nodosum Rt17-B1
Deposited on 2010-06-05, released 2011-06-22
The last revision was dated 2011-06-22, with a file datestamp of 2011-06-17.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.223
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endoglucanase FnCel5A
    Species: Fervidobacterium nodosum [TaxId:381764]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Endoglucanase FnCel5A
    Species: Fervidobacterium nodosum [TaxId:381764]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: peptide (ALA)(ASN)(GLU)
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3NCO (0-2)
  • Chain 'E':
    Compound: peptide (ALA)(ASP)(GLN)
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3NCO (0-2)
  • Heterogens: PO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3ncoA (A:)
    mdqsvsnvdkssafeynkmighginmgnaleapvegswgvyiedeyfkiikergfdsvri
    pirwsahisekypyeidkffldrvkhvvdvalkndlvviinchhfeelyqapdkygpvlv
    eiwkqvaqafkdypdklffeifnepaqnltptkwnelypkvlgeirktnpsriviidvpn
    wsnysyvrelklvddkniivsfhyyepfnfthqgaewvsptlpigvkwegkdweveqirn
    hfkyvsewakknnvpiflgefgayskadmesrvkwtktvrriaeefgfslaywefcagfg
    lydrwtktwieplttsalgk
    

    Sequence, based on observed residues (ATOM records):
    >3ncoA (A:)
    vdkssafeynkmighginmgnaleapvegswgvyiedeyfkiikergfdsvripirwsah
    isekypyeidkffldrvkhvvdvalkndlvviinchhfeelyqapdkygpvlveiwkqva
    qafkdypdklffeifnepaqnltptkwnelypkvlgeirktnpsriviidvpnwsnysyv
    relklvddkniivsfhyyepfnfthqgaewvsptlpigvkwegkdweveqirnhfkyvse
    wakknnvpiflgefgayskadmesrvkwtktvrriaeefgfslaywefcagfglydrwtk
    twieplttsalgk
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3ncoB (B:)
    mdqsvsnvdkssafeynkmighginmgnaleapvegswgvyiedeyfkiikergfdsvri
    pirwsahisekypyeidkffldrvkhvvdvalkndlvviinchhfeelyqapdkygpvlv
    eiwkqvaqafkdypdklffeifnepaqnltptkwnelypkvlgeirktnpsriviidvpn
    wsnysyvrelklvddkniivsfhyyepfnfthqgaewvsptlpigvkwegkdweveqirn
    hfkyvsewakknnvpiflgefgayskadmesrvkwtktvrriaeefgfslaywefcagfg
    lydrwtktwieplttsalgk
    

    Sequence, based on observed residues (ATOM records):
    >3ncoB (B:)
    dkssafeynkmighginmgnaleapvegswgvyiedeyfkiikergfdsvripirwsahi
    sekypyeidkffldrvkhvvdvalkndlvviinchhfeelyqapdkygpvlveiwkqvaq
    afkdypdklffeifnepaqnltptkwnelypkvlgeirktnpsriviidvpnwsnysyvr
    elklvddkniivsfhyyepfnfthqgaewvsptlpigvkwegkdweveqirnhfkyvsew
    akknnvpiflgefgayskadmesrvkwtktvrriaeefgfslaywefcagfglydrwtkt
    wieplttsalgk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records:
    >3ncoD (D:)
    ane
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records:
    >3ncoE (E:)
    adq