PDB entry 3ncm

View 3ncm on RCSB PDB site
Description: neural cell adhesion molecule, module 2, nmr, 20 structures
Class: cell adhesion protein
Keywords: cell adhesion, glycoprotein, heparin-binding, gpi-anchor, neural adhesion molecule, immunoglobulin fold, homophilic binding, cell adhesion protein
Deposited on 1998-09-21, released 1999-07-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (neural cell adhesion molecule, large isoform)
  Species: Rattus norvegicus [TaxId:10116]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P13594 (0-91)
    • cloning artifact (0-1)
  Domains in SCOPe 2.07: d3ncma1, d3ncma2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3ncmA (A:)
  yvmfknaptpqefkegedavivcdvvsslpptiiwkhkgrdvilkkdvrfivlsnnylqi
  rgikktdegtyrcegrilargeinfkdiqviv