PDB entry 3nck

View 3nck on RCSB PDB site
Description: crystal structure of blac-e166a covalently bound with nafcillin
Deposited on 2010-06-04, released 2011-12-14
The last revision was dated 2018-10-03, with a file datestamp of 2018-09-28.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: blaA, blaC, MT2128, MTCY49.07c, Rv2068c
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NFF, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nckA (A:)
    dladrfaelerrydarlgvyvpatgttaaieyraderfafcstfkaplvaavlhqnplth
    ldklitytsddirsispvaqqhvqtgmtigqlcdaairysdgtaanllladlggpgggta
    aftgylrslgdtvsrldaeapelnrdppgderdtttphaialvlqqlvlgnalppdkral
    ltdwmarnttgakriragfpadwkvidktgtgdygrandiavvwsptgvpyvvavmsdra
    gggydaepreallaeaatcvagvla
    

    Sequence, based on observed residues (ATOM records):
    >3nckA (A:)
    dladrfaelerrydarlgvyvpatgttaaieyraderfafcstfkaplvaavlhqnplth
    ldklitytsddirsispvaqqhvqtgmtigqlcdaairysdgtaanllladlggpgggta
    aftgylrslgdtvsrldppgderdtttphaialvlqqlvlgnalppdkralltdwmarnt
    tgakriragfpadwkvidktgtgdygrandiavvwsptgvpyvvavmsdragggydaepr
    eallaeaatcvagvla