PDB entry 3ncj

View 3ncj on RCSB PDB site
Description: Crystal structure of Fab15 Mut8
Class: immune system
Keywords: antibody, IMMUNE SYSTEM
Deposited on 2010-06-04, released 2010-08-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-08-18, with a file datestamp of 2010-08-13.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.202
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'H':
  Compound: Fab15 Mut8 heavy chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 3NCJ (0-224)
• Chain 'L':
  Compound: Fab15 Mut8 light chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 3NCJ (0-213)
  Domains in SCOPe 2.07: d3ncjl1, d3ncjl2
• Heterogens: ZN, ACT, GOL, HOH

PDB Chain Sequences:

• Chain 'H':
  No sequence available.
  
  
• Chain 'L':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3ncjL (L:)
  diqmtqspsslsasvgdrvtitcrasqsiglylawyqqkpgkapklliyaasslqsgvps
  rfsgsgsgtdftltisslqpedfatyycqqgntlpytfgqgtkveikrtvaapsvfifpp
  sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
  lskadyekhkvyacevthqglsspvtksfnrgec