PDB entry 3nci

View 3nci on RCSB PDB site
Description: RB69 DNA Polymerase Ternary Complex with dCTP Opposite dG at 1.8 angstrom resolution
Class: transferase/DNA
Keywords: RB69 DNA polymerase, fidelity,base selectivity, TRANSFERASE-DNA complex
Deposited on 2010-06-04, released 2011-02-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-06-19, with a file datestamp of 2013-06-14.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: 0.176
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase
    Species: Enterobacteria phage RB69 [TaxId:12353]
    Gene: 43, gp43
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q38087 (0-902)
      • engineered (221)
      • engineered (326)
    Domains in SCOPe 2.07: d3ncia1, d3ncia2
  • Chain 'P':
    Compound: DNA (5'-d(*gp*cp*gp*gp*ap*cp*tp*gp*cp*tp*tp*ap*(doc))-3')
  • Chain 'T':
    Compound: DNA (5'-d(*tp*cp*ap*gp*gp*tp*ap*ap*gp*cp*ap*gp*tp*cp*cp*gp*cp*g)-3')
  • Heterogens: DCP, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nciA (A:)
    mkefyltveqigdsiferyidsngrertreveykpslfahcpesqatkyfdiygkpctrk
    lfanmrdasqwikrmediglealgmddfklaylsdtynyeikydhtkirvanfdievtsp
    dgfpepsqakhpidaithydsiddrfyvfdllnspygnveewsieiaaklqeqggdevps
    eiidkiiympfdnekellmeylnfwqqktpviltgwnvesfaipyvynriknifgestak
    rlsphrktrvkvienmygsreiitlfgisvldyidlykkfsftnqpsysldyisefelnv
    gklkydgpisklresnhqryisyniiavyrvlqidakrqfinlsldmgyyakiqiqsvfs
    piktwdaiifnslkeqnkvipqgrshpvqpypgafvkepipnrykyvmsfdltslypsii
    rqvnispetiagtfkvaplhdyinavaerpsdvyscspngmmyykdrdgvvpteitkvfn
    qrkehkgymlaaqrngeiikealhnpnlsvdepldvdyrfdfsdeikekikklsakslne
    mlfraqrtevagmtaqinrkllinslygalgnvwfryydlrnataittfgqmalqwierk
    vneylnevcgtegeafvlygdtdsiyvsadkiidkvgeskfrdtnhwvdfldkfarerme
    paidrgfremceymnnkqhlmfmdreaiagpplgskgiggfwtgkkryalnvwdmegtry
    aepklkimgletqksstpkavqkalkecirrmlqegeeslqeyfkefekefrqlnyisia
    svssanniakydvggfpgpkcpfhirgiltynraikgnidapqvvegekvyvlplregnp
    fgdkciawpsgteitdlikddvlhwmdytvllektfikplegftsaakldyekkaslfdm
    fdf
    

  • Chain 'P':
    No sequence available.

  • Chain 'T':
    No sequence available.