PDB entry 3nch

View 3nch on RCSB PDB site
Description: Yeast Glycogen Synthase (Gsy2p) Basal State Conformation
Deposited on 2010-06-04, released 2010-10-06
The last revision was dated 2010-10-20, with a file datestamp of 2010-10-15.
Experiment type: XRAY
Resolution: 2.88 Å
R-factor: 0.215
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycogen [starch] synthase isoform 2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: GSY2, L8479.8, YLR258W
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27472
      • see remark 999 (554)
      • engineered mutation (599-600)
      • engineered mutation (602)
  • Chain 'B':
    Compound: Glycogen [starch] synthase isoform 2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: GSY2, L8479.8, YLR258W
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27472
      • see remark 999 (554)
      • engineered mutation (599-600)
      • engineered mutation (602)
  • Chain 'C':
    Compound: Glycogen [starch] synthase isoform 2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: GSY2, L8479.8, YLR258W
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27472
      • see remark 999 (554)
      • engineered mutation (599-600)
      • engineered mutation (602)
  • Chain 'D':
    Compound: Glycogen [starch] synthase isoform 2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: GSY2, L8479.8, YLR258W
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27472
      • see remark 999 (554)
      • engineered mutation (599-600)
      • engineered mutation (602)
  • Heterogens: SO4

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nchA (A:)
    mgsshhhhhhssglvprgshmsrdlqnhllfetatevanrvggiysvlkskapitvaqyk
    dhyhligplnkatyqnevdildwkkpeafsdemrpvqhalqtmesrgvhfvygrwliega
    pkvilfdldsvrgysnewkgdlwslvgipspendfetndaillgytvawflgevahldsq
    haivahfhewlagvalplcrkrridvvtiftthatllgrylcasgsfdfynclesvdvdh
    eagrfgiyhrycieraaahsadvfttvsqitafeaehllkrkpdgilpnglnvikfqafh
    efqnlhalkkekindfvrghfhgcfdfdldntlyffiagryeyknkgadmfiealarlny
    rlkvsgskktvvafivmpaknnsftvealkgqaevralentvhevttsigkrifdhairy
    phnglttelptdlgellkssdkvmlkrrilalrrpegqlppivthnmvddandlilnkir
    qvqlfnspsdrvkmifhpeflnannpilgldydefvrgchlgvfpsyyepwgytpaectv
    mgvpsittnvsgfgsymedlietnqakdygiyivdrrfkapdesveqlvdymeefvkkta
    aqainqrnrterlsdlldwkrmgleyvkarqlalrrgypdqfrelvgeelndsnmdalag
    gkklkvarplsvpgsprdlrsnstvymtpgdlgtlqevnnaddyfslgvnpaadddddgp
    yadds
    

    Sequence, based on observed residues (ATOM records):
    >3nchA (A:)
    srdlqnhllfetatevanrvggiysvlkskapitvaqykdhyhligplnkatyqnevdil
    dwkkpeafsdemrpvqhalqtmesrgvhfvygrwliegapkvilfdldsvrgysnewkgd
    lwslvgipspendfetndaillgytvawflgevahldsqhaivahfhewlagvalplcrk
    rridvvtiftthatllgrylcasgdfynclesvdvdheagrfgiyhrycieraaahsadv
    fttvsqitafeaehllkrkpdgilpnglnvikfqlhalkkekindfvrghfhgcfdfdld
    ntlyffiagryeyknkgadmfiealarlnyrlkvsgskktvvafivmpaknnsftvealk
    gqaevralentvhevttsigkrifdhairypellkssdkvmlkrrilalrrpegqlppiv
    thnmvddandlilnkirqvqlfnspsdrvkmifhpeflnannpilgldydefvrgchlgv
    fpsyyepwgytpaectvmgvpsittnvsgfgsymedlakdygiyivdrrfkapdesveql
    vdymeefvkktaaqainqrnrterlsdlldwkrmgleyvkarqlalrrgypdqfrelvge
    elndsnmdala
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nchB (B:)
    mgsshhhhhhssglvprgshmsrdlqnhllfetatevanrvggiysvlkskapitvaqyk
    dhyhligplnkatyqnevdildwkkpeafsdemrpvqhalqtmesrgvhfvygrwliega
    pkvilfdldsvrgysnewkgdlwslvgipspendfetndaillgytvawflgevahldsq
    haivahfhewlagvalplcrkrridvvtiftthatllgrylcasgsfdfynclesvdvdh
    eagrfgiyhrycieraaahsadvfttvsqitafeaehllkrkpdgilpnglnvikfqafh
    efqnlhalkkekindfvrghfhgcfdfdldntlyffiagryeyknkgadmfiealarlny
    rlkvsgskktvvafivmpaknnsftvealkgqaevralentvhevttsigkrifdhairy
    phnglttelptdlgellkssdkvmlkrrilalrrpegqlppivthnmvddandlilnkir
    qvqlfnspsdrvkmifhpeflnannpilgldydefvrgchlgvfpsyyepwgytpaectv
    mgvpsittnvsgfgsymedlietnqakdygiyivdrrfkapdesveqlvdymeefvkkta
    aqainqrnrterlsdlldwkrmgleyvkarqlalrrgypdqfrelvgeelndsnmdalag
    gkklkvarplsvpgsprdlrsnstvymtpgdlgtlqevnnaddyfslgvnpaadddddgp
    yadds
    

    Sequence, based on observed residues (ATOM records):
    >3nchB (B:)
    srdlqnhllfetatevanrvggiysvlkskapitvaqykdhyhligplnkatyqnevdil
    dwkkpeafsdemrpvqhalqtmesrgvhfvygrwliegapkvilfdldsvrgysnewkgd
    lwslvgipspendfetndaillgytvawflgevahldsqhaivahfhewlagvalplcrk
    rridvvtiftthatllgrylcasgdfynclesvdvdheagrfgiyhrycieraaahsadv
    fttvsqitafeaehllkrkpdgilpnglnvikfqlhalkkekindfvrghfhgcfdfdld
    ntlyffiagryeyknkgadmfiealarlnyrlkvsgskktvvafivmpaknnsftvealk
    gqaevralentvhevttsigkrifdhairypgellkssdkvmlkrrilalrrpegqlppi
    vthnmvddandlilnkirqvqlfnspsdrvkmifhpeflnannpilgldydefvrgchlg
    vfpsyyepwgytpaectvmgvpsittnvsgfgsymedlakdygiyivdrrfkapdesveq
    lvdymeefvkktaaqainqrnrterlsdlldwkrmgleyvkarqlalrrgypdqfrelvg
    eelndsnmdala
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3nchC (C:)
    mgsshhhhhhssglvprgshmsrdlqnhllfetatevanrvggiysvlkskapitvaqyk
    dhyhligplnkatyqnevdildwkkpeafsdemrpvqhalqtmesrgvhfvygrwliega
    pkvilfdldsvrgysnewkgdlwslvgipspendfetndaillgytvawflgevahldsq
    haivahfhewlagvalplcrkrridvvtiftthatllgrylcasgsfdfynclesvdvdh
    eagrfgiyhrycieraaahsadvfttvsqitafeaehllkrkpdgilpnglnvikfqafh
    efqnlhalkkekindfvrghfhgcfdfdldntlyffiagryeyknkgadmfiealarlny
    rlkvsgskktvvafivmpaknnsftvealkgqaevralentvhevttsigkrifdhairy
    phnglttelptdlgellkssdkvmlkrrilalrrpegqlppivthnmvddandlilnkir
    qvqlfnspsdrvkmifhpeflnannpilgldydefvrgchlgvfpsyyepwgytpaectv
    mgvpsittnvsgfgsymedlietnqakdygiyivdrrfkapdesveqlvdymeefvkkta
    aqainqrnrterlsdlldwkrmgleyvkarqlalrrgypdqfrelvgeelndsnmdalag
    gkklkvarplsvpgsprdlrsnstvymtpgdlgtlqevnnaddyfslgvnpaadddddgp
    yadds
    

    Sequence, based on observed residues (ATOM records):
    >3nchC (C:)
    srdlqnhllfetatevanrvggiysvlkskapitvaqykdhyhligplnkatyqnevdil
    dwkkpeafsdemrpvqhalqtmesrgvhfvygrwliegapkvilfdldsvrgysnewkgd
    lwslvgipspendfetndaillgytvawflgevahldsqhaivahfhewlagvalplcrk
    rridvvtiftthatllgrylcasgdfynclesvdvdheagrfgiyhrycieraaahsadv
    fttvsqitafeaehllkrkpdgilpnglnvikfqnlhalkkekindfvrghfhgcfdfdl
    dntlyffiagryeyknkgadmfiealarlnyrlkvsgskktvvafivmpaknnsftveal
    kgqaevralentvhevttsigkrifdhairypgellkssdkvmlkrrilalrrpegqlpp
    ivthnmvddandlilnkirqvqlfnspsdrvkmifhpeflnannpilgldydefvrgchl
    gvfpsyyepwgytpaectvmgvpsittnvsgfgsymedlakdygiyivdrrfkapdesve
    qlvdymeefvkktaaqainqrnrterlsdlldwkrmgleyvkarqlalrrgypdqfrelv
    geelndsnmdala
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3nchD (D:)
    mgsshhhhhhssglvprgshmsrdlqnhllfetatevanrvggiysvlkskapitvaqyk
    dhyhligplnkatyqnevdildwkkpeafsdemrpvqhalqtmesrgvhfvygrwliega
    pkvilfdldsvrgysnewkgdlwslvgipspendfetndaillgytvawflgevahldsq
    haivahfhewlagvalplcrkrridvvtiftthatllgrylcasgsfdfynclesvdvdh
    eagrfgiyhrycieraaahsadvfttvsqitafeaehllkrkpdgilpnglnvikfqafh
    efqnlhalkkekindfvrghfhgcfdfdldntlyffiagryeyknkgadmfiealarlny
    rlkvsgskktvvafivmpaknnsftvealkgqaevralentvhevttsigkrifdhairy
    phnglttelptdlgellkssdkvmlkrrilalrrpegqlppivthnmvddandlilnkir
    qvqlfnspsdrvkmifhpeflnannpilgldydefvrgchlgvfpsyyepwgytpaectv
    mgvpsittnvsgfgsymedlietnqakdygiyivdrrfkapdesveqlvdymeefvkkta
    aqainqrnrterlsdlldwkrmgleyvkarqlalrrgypdqfrelvgeelndsnmdalag
    gkklkvarplsvpgsprdlrsnstvymtpgdlgtlqevnnaddyfslgvnpaadddddgp
    yadds
    

    Sequence, based on observed residues (ATOM records):
    >3nchD (D:)
    srdlqnhllfetatevanrvggiysvlkskapitvaqykdhyhligplnkatyqnevdil
    dwkkpeafsdemrpvqhalqtmesrgvhfvygrwliegapkvilfdldsvrgysnewkgd
    lwslvgipspendfetndaillgytvawflgevahldsqhaivahfhewlagvalplcrk
    rridvvtiftthatllgrylcasgdfynclesvdvdheagrfgiyhrycieraaahsadv
    fttvsqitafeaehllkrkpdgilpnglnvikfqlhalkkekindfvrghfhgcfdfdld
    ntlyffiagryeyknkgadmfiealarlnyrlkvsgskktvvafivmpaknnsftvealk
    gqaevralentvhevttsigkrifdhairypgellkssdkvmlkrrilalrrpegqlppi
    vthnmvddandlilnkirqvqlfnspsdrvkmifhpeflnannpilgldydefvrgchlg
    vfpsyyepwgytpaectvmgvpsittnvsgfgsymedlakdygiyivdrrfkapdesveq
    lvdymeefvkktaaqainqrnrterlsdlldwkrmgleyvkarqlalrrgypdqfrelvg
    eelndsnmdala