PDB entry 3nce

View 3nce on RCSB PDB site
Description: A mutant human Prolactin receptor antagonist H27A in complex with the mutant extracellular domain H188A of the human prolactin receptor
Class: hormone/hormone receptor
Keywords: pH dependence, hematopoietic cytokine, HORMONE-HORMONE RECEPTOR complex
Deposited on 2010-06-04, released 2010-09-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Prolactin
    Species: Homo sapiens [TaxId:9606]
    Gene: hPRL, PRL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01236 (1-185)
      • initiating methionine (0)
      • engineered mutation (13)
      • engineered mutation (115)
    Domains in SCOPe 2.07: d3ncea_
  • Chain 'B':
    Compound: Prolactin receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: hPRLr, PRLR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16471 (1-End)
      • initiating methionine (0)
      • engineered mutation (187)
    Domains in SCOPe 2.07: d3nceb1, d3nceb2
  • Heterogens: NA, CO3, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nceA (A:)
    mlrdlfdravvlsayihnlssemfsefdkrythgrgfitkainschtsslatpedkeqaq
    qmnqkdflslivsilrswneplyhlvtevrgmqeapeailskaveieeqtkrllermeli
    vsqvhpetkeneiypvwsglpslqmadeesrlsayynllhclrrdshkidnylkllkcri
    ihnnnc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3nceB (B:)
    mlppgkpeifkcrspnketftcwwrpgtdgglptnysltyhregetlmhecpdyitggpn
    schfgkqytsmwrtyimmvnatnqmgssfsdelyvdvtyivqpdpplelavevkqpedrk
    pylwikwspptlidlktgwftllyeirlkpekaaeweihfagqqtefkilslhpgqkylv
    qvrckpdagywsawspatfiqipsdftmnd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nceB (B:)
    mlppgkpeifkcrspnketftcwwrpgtdgglptnysltyhregetlmhecpdyitggpn
    schfgkqytsmwrtyimmvnatnqmgssfsdelyvdvtyivqpdpplelavevkqpedrk
    pylwikwspptlidlktgwftllyeirlkpekaaeweihfagqqtefkilslhpgqkylv
    qvrckpdagywsawspatfiqipsdf