PDB entry 3ncc

View 3ncc on RCSB PDB site
Description: A human Prolactin receptor antagonist in complex with the mutant extracellular domain H188A of the human prolactin receptor
Class: hormone/hormone receptor
Keywords: pH dependence, hematopoietic cytokine, HORMONE-HORMONE RECEPTOR complex
Deposited on 2010-06-04, released 2010-09-29
The last revision prior to the SCOPe 2.02 freeze date was dated 2010-12-15, with a file datestamp of 2010-12-10.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.181
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Prolactin
    Species: Homo sapiens [TaxId:9606]
    Gene: hPRL, PRL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01236 (1-185)
      • initiating methionine (0)
      • engineered mutation (115)
    Domains in SCOPe 2.02: d3ncca_
  • Chain 'B':
    Compound: Prolactin receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: hPRLr, PRLR
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16471 (1-End)
      • initiating methionine (0)
      • engineered mutation (187)
  • Heterogens: NA, CL, CO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3nccA (A:)
mlrdlfdravvlshyihnlssemfsefdkrythgrgfitkainschtsslatpedkeqaq
qmnqkdflslivsilrswneplyhlvtevrgmqeapeailskaveieeqtkrllermeli
vsqvhpetkeneiypvwsglpslqmadeesrlsayynllhclrrdshkidnylkllkcri
ihnnnc

  • Chain 'B':
    No sequence available.