PDB entry 3nc9

View 3nc9 on RCSB PDB site
Description: x-ray structure of ketohexokinase complexed with an indazole compound
Deposited on 2010-06-04, released 2010-12-22
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ketohexokinase
    Species: Homo sapiens [TaxId:9606]
    Gene: KHK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50053-2 (19-312)
      • expression tag (17-18)
  • Chain 'B':
    Compound: Ketohexokinase
    Species: Homo sapiens [TaxId:9606]
    Gene: KHK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P50053-2 (19-312)
      • expression tag (14-18)
  • Heterogens: TR3, SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nc9A (A:)
    mgsshhhhhhssglvprgsqilcvglvvldvislvdkypkedseirclsqrwqrggnasn
    sctvlsllgapcafmgsmapghvadflvadfrrrgvdvsqvawqskgdtpsscciinnsn
    gnrtivlhdtslpdvsatdfekvdltqfkwihiegrnaseqvkmlqridahntrqppeqk
    irvsvevekpreelfqlfgygdvvfvskdvakhlgfqsaeealrglygrvrkgavlvcaw
    aeegadalgpdgkllhsdafppprvvdtlgagdtfnasvifslsqgrsvqealrfgcqva
    gkkcglqgfdgiv
    

    Sequence, based on observed residues (ATOM records):
    >3nc9A (A:)
    gsqilcvglvvldvislvdkypkedseirclsqrwqrggnasnsctvlsllgapcafmgs
    mapghvadflvadfrrrgvdvsqvawqskgdtpsscciinnsngnrtivlhdtslpdvsa
    tdfekvdltqfkwihiegrnaseqvkmlqridahntrqppeqkirvsvevekpreelfql
    fgygdvvfvskdvakhlgfqsaeealrglygrvrkgavlvcawaeegadalgpdgkllhs
    dafppprvvdtlgagdtfnasvifslsqgrsvqealrfgcqvagkkcglqgfdgiv
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nc9B (B:)
    mgsshhhhhhssglvprgsqilcvglvvldvislvdkypkedseirclsqrwqrggnasn
    sctvlsllgapcafmgsmapghvadflvadfrrrgvdvsqvawqskgdtpsscciinnsn
    gnrtivlhdtslpdvsatdfekvdltqfkwihiegrnaseqvkmlqridahntrqppeqk
    irvsvevekpreelfqlfgygdvvfvskdvakhlgfqsaeealrglygrvrkgavlvcaw
    aeegadalgpdgkllhsdafppprvvdtlgagdtfnasvifslsqgrsvqealrfgcqva
    gkkcglqgfdgiv
    

    Sequence, based on observed residues (ATOM records):
    >3nc9B (B:)
    glvprgsqilcvglvvldvislvdkypkedseirclsqrwqrggnasnsctvlsllgapc
    afmgsmapghvadflvadfrrrgvdvsqvawqskgdtpsscciinnsngnrtivlhdtsl
    pdvsatdfekvdltqfkwihiegrnaseqvkmlqridahntrqppeqkirvsvevekpre
    elfqlfgygdvvfvskdvakhlgfqsaeealrglygrvrkgavlvcawaeegadalgpdg
    kllhsdafppprvvdtlgagdtfnasvifslsqgrsvqealrfgcqvagkkcglqgfdgi
    v