PDB entry 3nc7

View 3nc7 on RCSB PDB site
Description: CYP134A1 2-phenylimidazole bound structure
Deposited on 2010-06-04, released 2010-08-11
The last revision was dated 2010-09-22, with a file datestamp of 2010-09-17.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: 0.215
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome P450 cypX
    Species: Bacillus subtilis [TaxId:1423]
    Gene: BSU35060, cyp134, cypB, cypX
    Database cross-references and differences (RAF-indexed):
    • Uniprot O34926
      • engineered mutation (391)
  • Chain 'B':
    Compound: Cytochrome P450 cypX
    Species: Bacillus subtilis [TaxId:1423]
    Gene: BSU35060, cyp134, cypB, cypX
    Database cross-references and differences (RAF-indexed):
    • Uniprot O34926
      • engineered mutation (391)
  • Heterogens: HEM, PIY, MG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nc7A (A:)
    mgsshhhhhhssglvprgshmasmtggqqmgrgsefmsqsiklfsvlsdqfqnnpyayfs
    qlreedpvhyeesidsyfisryhdvryilqhpdifttkslveraepvmrgpvlaqmhgke
    hsakrrivvrsfigdaldhlsplikqnaenllapylergksdlvndfgktfavcvtmdml
    gldkrdhekisewhsgvadfitsisqspearahslwcseqlsqylmpvikerrvnpgsdl
    isilctseyegmalsdkdilalilnvllaatepadktlalmiyhllnnpeqmndvladrs
    lvpraiaetlrykppvqliprqlsqdtvvggmeikkdtivfcmigaanrdpeafeqpdvf
    nihredlgiksafsgaarhlafgsgihncvgtafakneieivanivldkmrnirleedfc
    yaesglytrgpvsllvafdga
    

    Sequence, based on observed residues (ATOM records):
    >3nc7A (A:)
    iklfsvlsdqfqnnpyayfsqlreedpvhyeesidsyfisryhdvryilqhpdifttksl
    veraepvakrrivvrsfigdaldhlsplikqnaenllapylergksdlvndfgktfavcv
    tmdmlgldkrdhekisewhsgvadfitsisqspearahslwcseqlsqylmpvikerrvn
    pgsdlisilctsalsdkdilalilnvllaatepadktlalmiyhllnnpeqmndvladrs
    lvpraiaetlrykppvqliprqlsqdtvvggmeikkdtivfcmigaanrdpeafeqpdvf
    nihredlgiksafsgaarhlafgsgihncvgtafakneieivanivldkmrnirleedfc
    yaesglytrgpvsllvafd
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nc7B (B:)
    mgsshhhhhhssglvprgshmasmtggqqmgrgsefmsqsiklfsvlsdqfqnnpyayfs
    qlreedpvhyeesidsyfisryhdvryilqhpdifttkslveraepvmrgpvlaqmhgke
    hsakrrivvrsfigdaldhlsplikqnaenllapylergksdlvndfgktfavcvtmdml
    gldkrdhekisewhsgvadfitsisqspearahslwcseqlsqylmpvikerrvnpgsdl
    isilctseyegmalsdkdilalilnvllaatepadktlalmiyhllnnpeqmndvladrs
    lvpraiaetlrykppvqliprqlsqdtvvggmeikkdtivfcmigaanrdpeafeqpdvf
    nihredlgiksafsgaarhlafgsgihncvgtafakneieivanivldkmrnirleedfc
    yaesglytrgpvsllvafdga
    

    Sequence, based on observed residues (ATOM records):
    >3nc7B (B:)
    klfsvlsdqfqnnpyayfsqlreedpvhyeesidsyfisryhdvryilqhpdifttkslv
    eraepvmrgsakrrivvrsfigdaldhlsplikqnaenllapylergksdlvndfgktfa
    vcvtmdmlgldkrdhekisewhsgvadfitsisqspearahslwcseqlsqylmpviker
    rvnpgsdlisilctsealsdkdilalilnvllaatepadktlalmiyhllnnpeqmndvl
    adrslvpraiaetlrykppvqliprqlsqdtvvggmeikkdtivfcmigaanrdpeafeq
    pdvfnihredlgiksafsgaarhlafgsgihncvgtafakneieivanivldkmrnirle
    edfcyaesglytrgpvsllvafdg