PDB entry 3nc4

View 3nc4 on RCSB PDB site
Description: The binding of beta-D-glucopyranosyl-thiosemicarbazone derivatives to glycogen phosphorylase: a new class of inhibitors
Class: transferase/transferase inhibitor
Keywords: Glycogenolysis, type 2 diabetes, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2010-06-04, released 2011-01-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-01-05, with a file datestamp of 2010-12-31.
Experiment type: XRAY
Resolution: 2.07 Å
R-factor: 0.182
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycogen phosphorylase, muscle form
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nc4a_
  • Heterogens: 26O, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nc4A (A:)
    rplsdqekrkqisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvrd
    hlvgrwirtqqhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldmee
    leeieedaglgngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeeadd
    wlrygnpwekarpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvntm
    rlwsakapndfnlkdfnvggyiqavldrnlaenisrvlypndnffegkelrlkqeyfvva
    atlqdiirrfksskfgcrdpvrtnfdafpdkvaiqlndthpslaipelmrvlvdlerldw
    dkawevtvktcaytnhtvlpealerwpvhlletllprhlqiiyeinqrflnrvaaafpgd
    vdrlrrmslveegavkrinmahlciagshavngvarihseilkktifkdfyelephkfqn
    ktngitprrwlvlcnpglaeiiaerigeeyisdldqlrkllsyvddeafirdvakvkqen
    klkfaaylereykvhinpnslfdvqvkriheykrqllnclhvitlynrikkepnkfvvpr
    tvmiggkaapgyhmakmiiklitaigdvvnhdpvvgdrlrviflenyrvslaekvipaad
    lseqistagteasgtgnmkfmlngaltigtmdganvemaeeageenffifgmrvedvdrl
    dqrgynaqeyydripelrqiieqlssgffspkqpdlfkdivnmlmhhdrfkvfadyeeyv
    kcqervsalyknprewtrmvirniatsgkfssdrtiaqyareiwgvepsrqrlpapdeki
    p
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nc4A (A:)
    qisvrglagvenvtelkknfnrhlhftlvkdrnvatprdyyfalahtvrdhlvgrwirtq
    qhyyekdpkriyylslefymgrtlqntmvnlalenacdeatyqlgldmeeleeieedagl
    gngglgrlaacfldsmatlglaaygygiryefgifnqkicggwqmeeaddwlrygnpwek
    arpeftlpvhfygrvehtsqgakwvdtqvvlampydtpvpgyrnnvvntmrlwsakapnd
    fnlgyiqavldrnlaenisrvlypndnffegkelrlkqeyfvvaatlqdiirrfksstnf
    dafpdkvaiqlndthpslaipelmrvlvdlerldwdkawevtvktcaytnhtvlpealer
    wpvhlletllprhlqiiyeinqrflnrvaaafpgdvdrlrrmslveegavkrinmahlci
    agshavngvarihseilkktifkdfyelephkfqnktngitprrwlvlcnpglaeiiaer
    igeeyisdldqlrkllsyvddeafirdvakvkqenklkfaaylereykvhinpnslfdvq
    vkriheykrqllnclhvitlynrikkepnkfvvprtvmiggkaapgyhmakmiiklitai
    gdvvnhdpvvgdrlrviflenyrvslaekvipaadlseqistagteasgtgnmkfmlnga
    ltigtmdganvemaeeageenffifgmrvedvdrldqrgynaqeyydripelrqiieqls
    sgffspkqpdlfkdivnmlmhhdrfkvfadyeeyvkcqervsalyknprewtrmvirnia
    tsgkfssdrtiaqyareiwgvepsrqrlpa