PDB entry 3nc3

View 3nc3 on RCSB PDB site
Description: CYP134A1 structure with a closed substrate binding loop
Class: Oxidoreductase
Keywords: Cytochrome P450 Oxidase, Haem Protein, Oxidoreductase
Deposited on 2010-06-04, released 2010-08-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-09-22, with a file datestamp of 2010-09-17.
Experiment type: XRAY
Resolution: 2.66 Å
R-factor: 0.221
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome P450 cypX
    Species: Bacillus subtilis [TaxId:1423]
    Gene: BSU35060, cyp134, cypB, cypX
    Database cross-references and differences (RAF-indexed):
    • Uniprot O34926
      • engineered mutation (391)
    Domains in SCOPe 2.07: d3nc3a_
  • Chain 'B':
    Compound: Cytochrome P450 cypX
    Species: Bacillus subtilis [TaxId:1423]
    Gene: BSU35060, cyp134, cypB, cypX
    Database cross-references and differences (RAF-indexed):
    • Uniprot O34926
      • engineered mutation (391)
    Domains in SCOPe 2.07: d3nc3b_
  • Heterogens: HEM, GOL, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nc3A (A:)
    mgsshhhhhhssglvprgshmasmtggqqmgrgsefmsqsiklfsvlsdqfqnnpyayfs
    qlreedpvhyeesidsyfisryhdvryilqhpdifttkslveraepvmrgpvlaqmhgke
    hsakrrivvrsfigdaldhlsplikqnaenllapylergksdlvndfgktfavcvtmdml
    gldkrdhekisewhsgvadfitsisqspearahslwcseqlsqylmpvikerrvnpgsdl
    isilctseyegmalsdkdilalilnvllaatepadktlalmiyhllnnpeqmndvladrs
    lvpraiaetlrykppvqliprqlsqdtvvggmeikkdtivfcmigaanrdpeafeqpdvf
    nihredlgiksafsgaarhlafgsgihncvgtafakneieivanivldkmrnirleedfc
    yaesglytrgpvsllvafdga
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nc3A (A:)
    iklfsvlsdqfqnnpyayfsqlreedpvhyeesidsyfisryhdvryilqhpdifttksl
    veraepvmrakrrivvrsfigdaldhlsplikqnaenllapylergksdlvndfgktfav
    cvtmdmlgldkrdhekisewhsgvadfitsisqspearahslwcseqlsqylmpvikerr
    vnpgsdlisilctalsdkdilalilnvllaatepadktlalmiyhllnnpeqmndvladr
    slvpraiaetlrykppvqliprqlsqdtvvggmeikkdtivfcmigaanrdpeafeqpdv
    fnihredlgiksafsgaarhlafgsgihncvgtafakneieivanivldkmrnirleedf
    cyaesglytrgpvsllvafd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3nc3B (B:)
    mgsshhhhhhssglvprgshmasmtggqqmgrgsefmsqsiklfsvlsdqfqnnpyayfs
    qlreedpvhyeesidsyfisryhdvryilqhpdifttkslveraepvmrgpvlaqmhgke
    hsakrrivvrsfigdaldhlsplikqnaenllapylergksdlvndfgktfavcvtmdml
    gldkrdhekisewhsgvadfitsisqspearahslwcseqlsqylmpvikerrvnpgsdl
    isilctseyegmalsdkdilalilnvllaatepadktlalmiyhllnnpeqmndvladrs
    lvpraiaetlrykppvqliprqlsqdtvvggmeikkdtivfcmigaanrdpeafeqpdvf
    nihredlgiksafsgaarhlafgsgihncvgtafakneieivanivldkmrnirleedfc
    yaesglytrgpvsllvafdga
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nc3B (B:)
    iklfsvlsdqfqnnpyayfsqlreedpvhyeesidsyfisryhdvryilqhpdifttksl
    veraepvmrgpsakrrivvrsfigdaldhlsplikqnaenllapylergksdlvndfgkt
    favcvtmdmlgldkrdhekisewhsgvadfitsisqspearahslwcseqlsqylmpvik
    errvnpgsdlisilctsalsdkdilalilnvllaatepadktlalmiyhllnnpeqmndv
    ladrslvpraiaetlrykppvqliprqlsqdtvvggmeikkdtivfcmigaanrdpeafe
    qpdvfnihredlgiksafsgaarhlafgsgihncvgtafakneieivanivldkmrnirl
    eedfcyaesglytrgpvsllvafdg