PDB entry 3nc1

View 3nc1 on RCSB PDB site
Description: Crystal structure of the CRM1-RanGTP complex
Deposited on 2010-06-04, released 2010-10-27
The last revision was dated 2011-01-05, with a file datestamp of 2010-12-31.
Experiment type: XRAY
Resolution: 3.35 Å
R-factor: 0.221
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Exportin-1
    Species: Mus musculus [TaxId:10090]
    Gene: Crm1, Xpo1, Xpo1 (GeneID: 103573)
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: GTP-binding nuclear protein ran
    Species: Homo sapiens [TaxId:9606]
    Gene: ARA24, OK/SW-cl.81, RAN, RAN (GeneID: 5901)
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62826 (Start-181)
      • engineered (70)
  • Heterogens: GTP, MG

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nc1A (A:)
    gsmpaimtmladhaarqlldfsqkldinlldnvvnclyhgegaqqrmaqevlthlkehpd
    awtrvdtilefsqnmntkyyglqilenviktrwkilprnqcegikkyvvgliiktssdpt
    cvekekvyigklnmilvqilkqewpkhwptfisdivgasrtseslcqnnmvilkllseev
    fdfssgqitqvkakhlkdsmcnefsqifqlcqfvmensqnaplvhatletllrflnwipl
    gyifetklistliykflnvpmfrnvslkclteiagvsvsqyeeqfetlftltmmqlkqml
    plntnirlaysngkddeqnfiqnlslflctflkehgqllekrlnlrealmealhymllvs
    eveeteifkicleywnhlaaelyrespfstsaspllsgsqhfdipprrqlyltvlskvrl
    lmvsrmakpeevlvvendqgevvrefmkdtdsinlyknmretlvylthldyvdteiimtk
    klqnqvngtewswknlntlcwaigsisgamheedekrflvtvikdllglceqkrgkdnka
    iiasnimyivgqyprflrahwkflktvvnklfefmhethdgvqdmacdtfikiaqkcrrh
    fvqvqvgevmpfideilnnintiicdlqpqqvhtfyeavgymigaqtdqtvqehliekym
    llpnqvwdsiiqqatknvdilkdpetvkqlgsilktnvrackavghpfviqlgriyldml
    nvykclsenisaaiqangemvtkqplirsmrtvkretlklisgwvsrsndpqmvaenfvp
    plldavlidyqrnvpaarepevlstmaiivnklgghitaeipqifdavfectlnminkdf
    eeypehrtnfflllqavnshcfpaflaippaqfklvldsiiwafkhtmrnvadtglqilf
    tllqnvaqeeaaaqsfyqtyfcdilqhifsvvtdtshtagltmhasilaymfnlveegki
    stplnpgnpvnnqmfiqdyvanllksafphlqdaqvklfvtglfslnqdipafkehlrdf
    lvqikefagedtsdlfleeretalrqaqeekhklqmsvpgilnpheipeemcd
    

    Sequence, based on observed residues (ATOM records):
    >3nc1A (A:)
    dhaarqlldfsqkldinlldnvvnclyhgegaqqrmaqevlthlkehpdawtrvdtilef
    sqnmntkyyglqilenviktrwkilprnqcegikkyvvgliiktssdptcvekekvyigk
    lnmilvqilkqewpkhwptfisdivgasrtseslcqnnmvilkllseevfdfssgqitqv
    kakhlkdsmcnefsqifqlcqfvmensqnaplvhatletllrflnwiplgyifetklist
    liykflnvpmfrnvslkclteiagvsvsqyeeqfetlftltmmqlkqmlplntnirlays
    ngkddeqnfiqnlslflctflkehgqllekrlnlrealmealhymllvseveeteifkic
    leywnhlaaelyrespfstsdipprrqlyltvlskvrllmvsrmakpeevlvvendqgev
    vrefmkdtdsinlyknmretlvylthldyvdteiimtkklqnqvngtewswknlntlcwa
    igsisgamheedekrflvtvikdllglceqkrgkdnkaiiasnimyivgqyprflrahwk
    flktvvnklfefmhethdgvqdmacdtfikiaqkcrrhfvqvqvgevmpfideilnnint
    iicdlqpqqvhtfyeavgymigaqtdqtvqehliekymllpnqvwdsiiqqatknvdilk
    dpetvkqlgsilktnvrackavghpfviqlgriyldmlnvykclsenisaaiqangemvt
    kqplirsmrtvkretlklisgwvsrsndpqmvaenfvpplldavlidyqrnvpaarepev
    lstmaiivnklgghitaeipqifdavfectlnminkdfeeypehrtnfflllqavnshcf
    paflaippaqfklvldsiiwafkhtmrnvadtglqilftllqnvaqeeaaaqsfyqtyfc
    dilqhifsvvtdtshtagltmhasilaymfnlveegkistplnpnnqmfiqdyvanllks
    afphlqdaqvklfvtglfslnqdipafkehlrdflvqikefagedtsdlfleeretalrq
    aqeekh
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3nc1C (C:)
    gsmaaqgepqvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgp
    ikfnvwdtaglekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipiv
    lcgnkvdikdrkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefva
    mp
    

    Sequence, based on observed residues (ATOM records):
    >3nc1C (C:)
    qvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdta
    glekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdik
    drkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvamp