PDB entry 3nby

View 3nby on RCSB PDB site
Description: crystal structure of the pki nes-crm1-rangtp nuclear export complex
Deposited on 2010-06-04, released 2010-10-27
The last revision was dated 2011-01-05, with a file datestamp of 2010-12-31.
Experiment type: XRAY
Resolution: 3.42 Å
R-factor: 0.261
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Exportin-1
    Species: Mus musculus [TaxId:10090]
    Gene: Crm1, Xpo1, Xpo1 (GeneID: 103573)
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Snurportin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: PKIA (GeneID: 5569) SNUPN (GeneID: 10073), RNUT1, SNUPN, SPN1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O95149 (15-360)
      • expression tag (0-14)
  • Chain 'C':
    Compound: GTP-binding nuclear protein ran
    Species: Homo sapiens [TaxId:9606]
    Gene: ARA24, OK/SW-cl.81, RAN, RAN (GeneID: 5901)
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62826
      • engineered (64)
  • Chain 'D':
    Compound: Exportin-1
    Species: Mus musculus [TaxId:10090]
    Gene: Crm1, Xpo1, Xpo1 (GeneID: 103573)
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Snurportin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: PKIA (GeneID: 5569) SNUPN (GeneID: 10073), RNUT1, SNUPN, SPN1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O95149 (15-360)
      • expression tag (0-14)
  • Chain 'F':
    Compound: GTP-binding nuclear protein ran
    Species: Homo sapiens [TaxId:9606]
    Gene: ARA24, OK/SW-cl.81, RAN, RAN (GeneID: 5901)
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62826
      • engineered (64)
  • Heterogens: GTP, MG

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nbyA (A:)
    gsmpaimtmladhaarqlldfsqkldinlldnvvnclyhgegaqqrmaqevlthlkehpd
    awtrvdtilefsqnmntkyyglqilenviktrwkilprnqcegikkyvvgliiktssdpt
    cvekekvyigklnmilvqilkqewpkhwptfisdivgasrtseslcqnnmvilkllseev
    fdfssgqitqvkakhlkdsmcnefsqifqlcqfvmensqnaplvhatletllrflnwipl
    gyifetklistliykflnvpmfrnvslkclteiagvsvsqyeeqfetlftltmmqlkqml
    plntnirlaysngkddeqnfiqnlslflctflkehgqllekrlnlrealmealhymllvs
    eveeteifkicleywnhlaaelyrespfstsaspllsgsqhfdipprrqlyltvlskvrl
    lmvsrmakpeevlvvendqgevvrefmkdtdsinlyknmretlvylthldyvdteiimtk
    klqnqvngtewswknlntlcwaigsisgamheedekrflvtvikdllglceqkrgkdnka
    iiasnimyivgqyprflrahwkflktvvnklfefmhethdgvqdmacdtfikiaqkcrrh
    fvqvqvgevmpfideilnnintiicdlqpqqvhtfyeavgymigaqtdqtvqehliekym
    llpnqvwdsiiqqatknvdilkdpetvkqlgsilktnvrackavghpfviqlgriyldml
    nvykclsenisaaiqangemvtkqplirsmrtvkretlklisgwvsrsndpqmvaenfvp
    plldavlidyqrnvpaarepevlstmaiivnklgghitaeipqifdavfectlnminkdf
    eeypehrtnfflllqavnshcfpaflaippaqfklvldsiiwafkhtmrnvadtglqilf
    tllqnvaqeeaaaqsfyqtyfcdilqhifsvvtdtshtagltmhasilaymfnlveegki
    stplnpgnpvnnqmfiqdyvanllksafphlqdaqvklfvtglfslnqdipafkehlrdf
    lvqikefagedtsdlfleeretalrqaqeekhklqmsvpgilnpheipeemcd
    

    Sequence, based on observed residues (ATOM records):
    >3nbyA (A:)
    aarqlldfsqkldinlldnvvnclyhgegaqqrmaqevlthlkehpdawtrvdtisqnmn
    tkyyglqilenviktrwkilprnqcegikkyvvgliiktssdptcvekekvyigklnmil
    vqilkqewpkhwptfisdivgasrtseslcqnnmvilkllseevfdfssgqitqvkakhl
    kdsmcnefsqifqlcqfvmensqnaplvhatletllrflnwiplgyifetklistliykf
    lnvpmfrnvslkclteiagvsvsqyeeqfetlftltmmqlkqmlplntnirlaysngkdd
    eqnfiqnlslflctflkehgqllekrlnlrealmealhymllvseveeteifkicleywn
    hlaaelyrespfstsaspllsgsqhfdipprrqlyltvlskvrllmvsrmakpeevlvve
    ndqgevvrefmkdtdsinlyknmretlvylthldyvdteiimtkklqnqvngtewswknl
    ntlcwaigsisgamheedekrflvtvikdllglceqkrgkdnkaiiasnimyivgqyprf
    lrahwkflktvvnklfefmhethdgvqdmacdtfikiaqkcrrhfvqvqvgevmpfidei
    lnnintiicdlqpqqvhtfyeavgymigaqtdqtvqehliekymllpnqvwdsiiqqatk
    nvdilkdpetvkqlgsilktnvrackavghpfviqlgriyldmlnvykclsenisaaiqa
    ngemvtkqplirsmrtvkretlklisgwvsrsndpqmvaenfvpplldavlidyqrnvpa
    arepevlstmaiivnklgghitaeipqifdavfectlnminkdfeeypehrtnfflllqa
    vnshcfpaflaippaqfklvldsiiwafkhtmrnvadtglqilftllqnvaqeeaaaqsf
    yqtyfcdilqhifsvvtdtshtagltmhasilaymfnlveegkistplnpgnpvnnqmfi
    qdyvanllksafphlqdaqvklfvtglfslnqdipafkehlrdflvqikefagedtsdlf
    leeretalrqaqeekhklqms
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nbyB (B:)
    gslnelalklagldisqdlnstaaphprlsqykskyssleqserrrrllelqkskrldyv
    nharrlaeddwtgmeseeenkkddeemdidtvkklpkhyanqlmlsewlidvpsdlgqew
    ivvvcpvgkralivasrgstsaytksgycvnrfssllpggnrrnstakdytildciynev
    nqtyyvldvmcwrghpfydcqtdfrfywmhsklpeeeglgektklnpfkfvglknfpctp
    eslcdvlsmdfpfevdgllfyhkqthyspgstplvgwlrpymvsdvlgvavpagplttkp
    dyaghqlqqimehkksqkegmkeklthkasenghyelehlstpklkgsshspdhpgclme
    n
    

    Sequence, based on observed residues (ATOM records):
    >3nbyB (B:)
    gslnelalklagldisqdlnstaaphprlsqyssleqserrrrllelqkskrldyvnhar
    rlaeddwtkklpkhyanqlmlsewlidvpsdlgqewivvvcpvgkralivasrgstsayt
    ksgycvnrfssllpggnrakdytildciynevnqtyyvldvmcwrghpfydcqtdfrfyw
    mhsklpeeeglgektklnpfkfvglknfpctpeslcdvlsmdfpfevdgllfyhkqthys
    pgstplvgwlrpymvsdvlghspdhpgclmen
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3nbyC (C:)
    gepqvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvw
    dtaglekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkv
    dikdrkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvamp
    

    Sequence, based on observed residues (ATOM records):
    >3nbyC (C:)
    vqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdtag
    lekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdikd
    rkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvam
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3nbyD (D:)
    gsmpaimtmladhaarqlldfsqkldinlldnvvnclyhgegaqqrmaqevlthlkehpd
    awtrvdtilefsqnmntkyyglqilenviktrwkilprnqcegikkyvvgliiktssdpt
    cvekekvyigklnmilvqilkqewpkhwptfisdivgasrtseslcqnnmvilkllseev
    fdfssgqitqvkakhlkdsmcnefsqifqlcqfvmensqnaplvhatletllrflnwipl
    gyifetklistliykflnvpmfrnvslkclteiagvsvsqyeeqfetlftltmmqlkqml
    plntnirlaysngkddeqnfiqnlslflctflkehgqllekrlnlrealmealhymllvs
    eveeteifkicleywnhlaaelyrespfstsaspllsgsqhfdipprrqlyltvlskvrl
    lmvsrmakpeevlvvendqgevvrefmkdtdsinlyknmretlvylthldyvdteiimtk
    klqnqvngtewswknlntlcwaigsisgamheedekrflvtvikdllglceqkrgkdnka
    iiasnimyivgqyprflrahwkflktvvnklfefmhethdgvqdmacdtfikiaqkcrrh
    fvqvqvgevmpfideilnnintiicdlqpqqvhtfyeavgymigaqtdqtvqehliekym
    llpnqvwdsiiqqatknvdilkdpetvkqlgsilktnvrackavghpfviqlgriyldml
    nvykclsenisaaiqangemvtkqplirsmrtvkretlklisgwvsrsndpqmvaenfvp
    plldavlidyqrnvpaarepevlstmaiivnklgghitaeipqifdavfectlnminkdf
    eeypehrtnfflllqavnshcfpaflaippaqfklvldsiiwafkhtmrnvadtglqilf
    tllqnvaqeeaaaqsfyqtyfcdilqhifsvvtdtshtagltmhasilaymfnlveegki
    stplnpgnpvnnqmfiqdyvanllksafphlqdaqvklfvtglfslnqdipafkehlrdf
    lvqikefagedtsdlfleeretalrqaqeekhklqmsvpgilnpheipeemcd
    

    Sequence, based on observed residues (ATOM records):
    >3nbyD (D:)
    aarqlldfsqkldinlldnvvnclyhgegaqqrmaqevlthlkehpdawtrvdtisqnmn
    tkyyglqilenviktrwkilprnqcegikkyvvgliiktssdptcvekekvyigklnmil
    vqilkqewpkhwptfisdivgasrtseslcqnnmvilkllseevfdfssgqitqvkakhl
    kdsmcnefsqifqlcqfvmensqnaplvhatletllrflnwiplgyifetklistliykf
    lnvpmfrnvslkclteiagvsvsqyeeqfetlftltmmqlkqmlplntnirlaysngkdd
    eqnfiqnlslflctflkehgqllekrlnlrealmealhymllvseveeteifkicleywn
    hlaaelyrespfstsaspllsgsqhfdipprrqlyltvlskvrllmvsrmakpeevlvve
    ndqgevvrefmkdtdsinlyknmretlvylthldyvdteiimtkklqnqvngtewswknl
    ntlcwaigsisgamheedekrflvtvikdllglceqkrgkdnkaiiasnimyivgqyprf
    lrahwkflktvvnklfefmhethdgvqdmacdtfikiaqkcrrhfvqvqvgevmpfidei
    lnnintiicdlqpqqvhtfyeavgymigaqtdqtvqehliekymllpnqvwdsiiqqatk
    nvdilkdpetvkqlgsilktnvrackavghpfviqlgriyldmlnvykclsenisaaiqa
    ngemvtkqplirsmrtvkretlklisgwvsrsndpqmvaenfvpplldavlidyqrnvpa
    arepevlstmaiivnklgghitaeipqifdavfectlnminkdfeeypehrtnfflllqa
    vnshcfpaflaippaqfklvldsiiwafkhtmrnvadtglqilftllqnvaqeeaaaqsf
    yqtyfcdilqhifsvvtdtshtagltmhasilaymfnlveegkistplnpgnpvnnqmfi
    qdyvanllksafphlqdaqvklfvtglfslnqdipafkehlrdflvqikefagedtsdlf
    leeretalrqaqeekhklqms
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >3nbyE (E:)
    gslnelalklagldisqdlnstaaphprlsqykskyssleqserrrrllelqkskrldyv
    nharrlaeddwtgmeseeenkkddeemdidtvkklpkhyanqlmlsewlidvpsdlgqew
    ivvvcpvgkralivasrgstsaytksgycvnrfssllpggnrrnstakdytildciynev
    nqtyyvldvmcwrghpfydcqtdfrfywmhsklpeeeglgektklnpfkfvglknfpctp
    eslcdvlsmdfpfevdgllfyhkqthyspgstplvgwlrpymvsdvlgvavpagplttkp
    dyaghqlqqimehkksqkegmkeklthkasenghyelehlstpklkgsshspdhpgclme
    n
    

    Sequence, based on observed residues (ATOM records):
    >3nbyE (E:)
    gslnelalklagldisqdlnstaaphprlsskyssleqserrrrllelqkskrldyvnha
    rrlaeddwtgmklpkhyanqlmlsewlidvpsdlgqewivvvcpvgkralivasrgstsa
    ytksgycvnrfssllpggnrakdytildciynevnqtyyvldvmcwrghpfydcqtdfrf
    ywmhsklpeeeglgektklnpfkfvglknfpctpeslcdvlsmdfpfevdgllfyhkqth
    yspgstplvgwlrpymvsdvlgvavhspdhpgclmen
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >3nbyF (F:)
    gepqvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvw
    dtaglekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkv
    dikdrkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvamp
    

    Sequence, based on observed residues (ATOM records):
    >3nbyF (F:)
    vqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdtag
    lekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdikd
    rkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvam