PDB entry 3nbu

View 3nbu on RCSB PDB site
Description: Crystal structure of pGI glucosephosphate isomerase
Class: isomerase
Keywords: isomerase
Deposited on 2010-06-04, released 2011-06-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-03-28, with a file datestamp of 2012-03-23.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.172
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glucose-6-phosphate isomerase
    Species: Escherichia coli [TaxId:668369]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6T1 (0-548)
      • variant (240)
    Domains in SCOPe 2.07: d3nbua_
  • Chain 'B':
    Compound: Glucose-6-phosphate isomerase
    Species: Escherichia coli [TaxId:668369]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6T1 (0-548)
      • variant (240)
    Domains in SCOPe 2.07: d3nbub_
  • Chain 'C':
    Compound: Glucose-6-phosphate isomerase
    Species: Escherichia coli [TaxId:668369]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6T1 (0-548)
      • variant (240)
    Domains in SCOPe 2.07: d3nbuc_
  • Chain 'D':
    Compound: Glucose-6-phosphate isomerase
    Species: Escherichia coli [TaxId:668369]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6T1 (0-548)
      • variant (240)
    Domains in SCOPe 2.07: d3nbud_
  • Chain 'E':
    Compound: Glucose-6-phosphate isomerase
    Species: Escherichia coli [TaxId:668369]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6T1 (0-548)
      • variant (240)
    Domains in SCOPe 2.07: d3nbue_
  • Chain 'F':
    Compound: Glucose-6-phosphate isomerase
    Species: Escherichia coli [TaxId:668369]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A6T1 (0-548)
      • variant (240)
    Domains in SCOPe 2.07: d3nbuf_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nbuA (A:)
    mkninptqtaawqalqkhfdemkdvtiadlfakdgdrfskfsatfddqmlvdysknrite
    etlaklqdlakecdlagaiksmfsgekinrtenravlhvalrnrsntpilvdgkdvmpev
    navlekmktfseaiisgewkgytgkaitdvvnigiggsdlgpymvtealrpyknhlnmhf
    vsnvdgthiaevlkkvnpettlflvasktfttqetmtnahsardwflkaagdekhvakhf
    talstnakavgefgidtanmfefwdwvggryslwsaiglsivlsigfdnfvellsgaham
    dkhfsttpaeknlpvllaligiwynnffgaeteailpydqymhrfaayfqqgnmesngky
    vdrngnvvdyqtgpiiwgepgtngqhafyqlihqgtkmvpcdfiapaithnplsdhhqkl
    lsnffaqtealafgksrevveqeyrdqgkdpatldyvvpfkvfegnrptnsillreitpf
    slgalialyehkiftqgvilniftfdqwgvelgkqlanrilpelkddkeisshdsstngl
    inrykawrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nbuA (A:)
    mkninptqtaawqalqkhfdemkdvtiadlfakdgdrfskfsatfddqmlvdysknrite
    etlaklqdlakecdlagaiksmfsgekinrtenravlhvalrnrsntpilvdgkdvmpev
    navlekmktfseaiisgewkgytgkaitdvvnigiggsdlgpymvtealrpyknhlnmhf
    vsnvdgthiaevlkkvnpettlflvasktfttqetmtnahsardwflkaagdekhvakhf
    talstngefgidtanmfefwdwvggryslwsaiglsivlsigfdnfvellsgahamdkhf
    sttpaeknlpvllaligiwynnffgaeteailpydqymhrfaayfqqgnmesngkyvdrn
    gnvvdyqtgpiiwgepgtngqhafyqlihqgtkmvpcdfiapaithnplsdhhqkllsnf
    faqtealafgksrevveqeyrdqgkdpatldyvvpfkvfegnrptnsillreitpfslga
    lialyehkiftqgvilniftfdqwgvelgkqlanrilpelkddkeisshdsstnglinry
    kawrg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nbuB (B:)
    mkninptqtaawqalqkhfdemkdvtiadlfakdgdrfskfsatfddqmlvdysknrite
    etlaklqdlakecdlagaiksmfsgekinrtenravlhvalrnrsntpilvdgkdvmpev
    navlekmktfseaiisgewkgytgkaitdvvnigiggsdlgpymvtealrpyknhlnmhf
    vsnvdgthiaevlkkvnpettlflvasktfttqetmtnahsardwflkaagdekhvakhf
    talstnakavgefgidtanmfefwdwvggryslwsaiglsivlsigfdnfvellsgaham
    dkhfsttpaeknlpvllaligiwynnffgaeteailpydqymhrfaayfqqgnmesngky
    vdrngnvvdyqtgpiiwgepgtngqhafyqlihqgtkmvpcdfiapaithnplsdhhqkl
    lsnffaqtealafgksrevveqeyrdqgkdpatldyvvpfkvfegnrptnsillreitpf
    slgalialyehkiftqgvilniftfdqwgvelgkqlanrilpelkddkeisshdsstngl
    inrykawrg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nbuC (C:)
    mkninptqtaawqalqkhfdemkdvtiadlfakdgdrfskfsatfddqmlvdysknrite
    etlaklqdlakecdlagaiksmfsgekinrtenravlhvalrnrsntpilvdgkdvmpev
    navlekmktfseaiisgewkgytgkaitdvvnigiggsdlgpymvtealrpyknhlnmhf
    vsnvdgthiaevlkkvnpettlflvasktfttqetmtnahsardwflkaagdekhvakhf
    talstnakavgefgidtanmfefwdwvggryslwsaiglsivlsigfdnfvellsgaham
    dkhfsttpaeknlpvllaligiwynnffgaeteailpydqymhrfaayfqqgnmesngky
    vdrngnvvdyqtgpiiwgepgtngqhafyqlihqgtkmvpcdfiapaithnplsdhhqkl
    lsnffaqtealafgksrevveqeyrdqgkdpatldyvvpfkvfegnrptnsillreitpf
    slgalialyehkiftqgvilniftfdqwgvelgkqlanrilpelkddkeisshdsstngl
    inrykawrg
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nbuD (D:)
    mkninptqtaawqalqkhfdemkdvtiadlfakdgdrfskfsatfddqmlvdysknrite
    etlaklqdlakecdlagaiksmfsgekinrtenravlhvalrnrsntpilvdgkdvmpev
    navlekmktfseaiisgewkgytgkaitdvvnigiggsdlgpymvtealrpyknhlnmhf
    vsnvdgthiaevlkkvnpettlflvasktfttqetmtnahsardwflkaagdekhvakhf
    talstnakavgefgidtanmfefwdwvggryslwsaiglsivlsigfdnfvellsgaham
    dkhfsttpaeknlpvllaligiwynnffgaeteailpydqymhrfaayfqqgnmesngky
    vdrngnvvdyqtgpiiwgepgtngqhafyqlihqgtkmvpcdfiapaithnplsdhhqkl
    lsnffaqtealafgksrevveqeyrdqgkdpatldyvvpfkvfegnrptnsillreitpf
    slgalialyehkiftqgvilniftfdqwgvelgkqlanrilpelkddkeisshdsstngl
    inrykawrg
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nbuE (E:)
    mkninptqtaawqalqkhfdemkdvtiadlfakdgdrfskfsatfddqmlvdysknrite
    etlaklqdlakecdlagaiksmfsgekinrtenravlhvalrnrsntpilvdgkdvmpev
    navlekmktfseaiisgewkgytgkaitdvvnigiggsdlgpymvtealrpyknhlnmhf
    vsnvdgthiaevlkkvnpettlflvasktfttqetmtnahsardwflkaagdekhvakhf
    talstnakavgefgidtanmfefwdwvggryslwsaiglsivlsigfdnfvellsgaham
    dkhfsttpaeknlpvllaligiwynnffgaeteailpydqymhrfaayfqqgnmesngky
    vdrngnvvdyqtgpiiwgepgtngqhafyqlihqgtkmvpcdfiapaithnplsdhhqkl
    lsnffaqtealafgksrevveqeyrdqgkdpatldyvvpfkvfegnrptnsillreitpf
    slgalialyehkiftqgvilniftfdqwgvelgkqlanrilpelkddkeisshdsstngl
    inrykawrg
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nbuF (F:)
    mkninptqtaawqalqkhfdemkdvtiadlfakdgdrfskfsatfddqmlvdysknrite
    etlaklqdlakecdlagaiksmfsgekinrtenravlhvalrnrsntpilvdgkdvmpev
    navlekmktfseaiisgewkgytgkaitdvvnigiggsdlgpymvtealrpyknhlnmhf
    vsnvdgthiaevlkkvnpettlflvasktfttqetmtnahsardwflkaagdekhvakhf
    talstnakavgefgidtanmfefwdwvggryslwsaiglsivlsigfdnfvellsgaham
    dkhfsttpaeknlpvllaligiwynnffgaeteailpydqymhrfaayfqqgnmesngky
    vdrngnvvdyqtgpiiwgepgtngqhafyqlihqgtkmvpcdfiapaithnplsdhhqkl
    lsnffaqtealafgksrevveqeyrdqgkdpatldyvvpfkvfegnrptnsillreitpf
    slgalialyehkiftqgvilniftfdqwgvelgkqlanrilpelkddkeisshdsstngl
    inrykawrg