PDB entry 3nbr

View 3nbr on RCSB PDB site
Description: Crystal Structure of Ketosteroid Isomerase D38NP39GD99N from Pseudomonas Testosteroni (tKSI) with 4-Androstene-3,17-dione Bound
Class: isomerase
Keywords: Isomerase
Deposited on 2010-06-03, released 2011-11-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.73 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: steroid delta-isomerase
    Species: Comamonas testosteroni [TaxId:285]
    Gene: ksi
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00947 (Start-124)
      • engineered mutation (37-38)
      • engineered mutation (98)
    Domains in SCOPe 2.07: d3nbra_
  • Heterogens: SO4, ASD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nbrA (A:)
    mntpehmtavvqryvaalnagdldgivalfaddatvengvgseprsgtaairefyanslk
    lplaveltqevravaneaafaftvsfeyqgrktvvapinhfrfngagkvvsmralfgekn
    ihaga
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nbrA (A:)
    ntpehmtavvqryvaalnagdldgivalfaddatvengvgseprsgtaairefyanslkl
    plaveltqevravaneaafaftvsfeyqgrktvvapinhfrfngagkvvsmralfgekni
    haga