PDB entry 3nbn

View 3nbn on RCSB PDB site
Description: crystal structure of a dimer of notch transcription complex trimers on hes1 dna
Deposited on 2010-06-03, released 2010-11-03
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 3.45 Å
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Recombining binding protein suppressor of hairless
    Species: Homo sapiens [TaxId:9606]
    Gene: IGKJRB, IGKJRB1, RBPJ, RBPJK, RBPSUH
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Neurogenic locus notch homolog protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: NOTCH1, TAN1
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Mastermind-like protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: KIAA0200, MAML1
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Recombining binding protein suppressor of hairless
    Species: Homo sapiens [TaxId:9606]
    Gene: IGKJRB, IGKJRB1, RBPJ, RBPJK, RBPSUH
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Neurogenic locus notch homolog protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: NOTCH1, TAN1
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Mastermind-like protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: KIAA0200, MAML1
    Database cross-references and differences (RAF-indexed):
  • Chain 'X':
    Compound: DNA, HES1 promoter
    Species: synthetic, synthetic
  • Chain 'Y':
    Compound: DNA, HES1 promoter
    Species: synthetic, synthetic

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nbnA (A:)
    mgerpppkrltreamrnylkergdqtvlilhakvaqksygnekrffcpppcvylmgsgwk
    kkkeqmerdgcseqesqpcafigignsdqemqqlnlegknyctaktlyisdsdkrkhfml
    svkmfygnsddigvflskrikviskpskkkqslknadlciasgtkvalfnrlrsqtvstr
    ylhveggnfhassqqwgaffihlldddesegeeftvrdgyihygqtvklvcsvtgmalpr
    liirkvdkqtalldaddpvsqlhkcafylkdtermylclsqeriiqfqatpcpkepnkem
    indgaswtiistdkaeytfyegmgpvlapvtpvpvveslqlngggdvamleltgqnftpn
    lrvwfgdveaetmyrcgesmlcvvpdisafregwrwvrqpvqvpvtlvrndgiiystslt
    ftytpephhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3nbnA (A:)
    pppkrltreamrnylkergdqtvlilhakvaqksygnekrffcpppcvylmgsgwkkkke
    qmerdgcseqesqpcafigignsdqemqqlnlegknyctaktlyisdsdkrkhfmlsvkm
    fygnsddigvflskrikviskpskkkqslknadlciasgtkvalfnrlrsqtvstrylhv
    eggnfhassqqwgaffihlldddesegeeftvrdgyihygqtvklvcsvtgmalprliir
    kvdkqtalldaddpvsqlhkcafylkdtermylclsqeriiqfqatpcpkepnkemindg
    aswtiistdkaeytfyegmgpvlapvtpvpvveslqlngggdvamleltgqnftpnlrvw
    fgdveaetmyrcgesmlcvvpdisafregwrwvrqpvqvpvtlvrndgiiystsltftyt
    pep
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nbnB (B:)
    gmdvnvrgpdgftplmiascsgggletgnseeeedapavisdfiyqgaslhnqtdrtget
    alhlaarysrsdaakrlleasadaniqdnmgrtplhaavsadaqgvfqilirnratdlda
    rmhdgttplilaarlavegmledlinshadvnavddlgksalhwaaavnnvdaavvllkn
    gankdmqnnreetplflaaregsyetakvlldhfanrditdhmdrlprdiaqermhhdiv
    rlldeynlvrspqlhg
    

    Sequence, based on observed residues (ATOM records):
    >3nbnB (B:)
    qtdrtgetalhlaarysrsdaakrlleasadaniqdnmgrtplhaavsadaqgvfqilir
    nratdldarmhdgttplilaarlavegmledlinshadvnavddlgksalhwaaavnnvd
    aavvllkngankdmqnnreetplflaaregsyetakvlldhfanrditdhmdrlprdiaq
    ermhhdivrlldeynl
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3nbnC (C:)
    glprhsavmerlrrrielcrrhhstcearyeavsperlelerqhtfalhqrciqakakra
    gkh
    

    Sequence, based on observed residues (ATOM records):
    >3nbnC (C:)
    hsavmerlrrrielcrrhhstcearyeavsperlelerqhtfalhqrciqakakr
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3nbnD (D:)
    mgerpppkrltreamrnylkergdqtvlilhakvaqksygnekrffcpppcvylmgsgwk
    kkkeqmerdgcseqesqpcafigignsdqemqqlnlegknyctaktlyisdsdkrkhfml
    svkmfygnsddigvflskrikviskpskkkqslknadlciasgtkvalfnrlrsqtvstr
    ylhveggnfhassqqwgaffihlldddesegeeftvrdgyihygqtvklvcsvtgmalpr
    liirkvdkqtalldaddpvsqlhkcafylkdtermylclsqeriiqfqatpcpkepnkem
    indgaswtiistdkaeytfyegmgpvlapvtpvpvveslqlngggdvamleltgqnftpn
    lrvwfgdveaetmyrcgesmlcvvpdisafregwrwvrqpvqvpvtlvrndgiiystslt
    ftytpephhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3nbnD (D:)
    pppkrltreamrnylkergdqtvlilhakvaqksygnekrffcpppcvylmgsgwkkkke
    qmerdgcseqesqpcafigignsdqemqqlnlegknyctaktlyisdsdkrkhfmlsvkm
    fygnsddigvflskrikviskpskkkqslknadlciasgtkvalfnrlrsqtvstrylhv
    eggnfhassqqwgaffihlldddesegeeftvrdgyihygqtvklvcsvtgmalprliir
    kvdkqtalldaddpvsqlhkcafylkdtermylclsqeriiqfqatpcpkepnkemindg
    aswtiistdkaeytfyegmgpvlapvtpvpvveslqlngggdvamleltgqnftpnlrvw
    fgdveaetmyrcgesmlcvvpdisafregwrwvrqpvqvpvtlvrndgiiystsltftyt
    pep
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >3nbnE (E:)
    gmdvnvrgpdgftplmiascsgggletgnseeeedapavisdfiyqgaslhnqtdrtget
    alhlaarysrsdaakrlleasadaniqdnmgrtplhaavsadaqgvfqilirnratdlda
    rmhdgttplilaarlavegmledlinshadvnavddlgksalhwaaavnnvdaavvllkn
    gankdmqnnreetplflaaregsyetakvlldhfanrditdhmdrlprdiaqermhhdiv
    rlldeynlvrspqlhg
    

    Sequence, based on observed residues (ATOM records):
    >3nbnE (E:)
    qtdrtgetalhlaarysrsdaakrlleasadaniqdnmgrtplhaavsadaqgvfqilir
    nratdldarmhdgttplilaarlavegmledlinshadvnavddlgksalhwaaavnnvd
    aavvllkngankdmqnnreetplflaaregsyetakvlldhfanrditdhmdrlprdiaq
    ermhhdivrlldeynl
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >3nbnF (F:)
    glprhsavmerlrrrielcrrhhstcearyeavsperlelerqhtfalhqrciqakakra
    gkh
    

    Sequence, based on observed residues (ATOM records):
    >3nbnF (F:)
    hsavmerlrrrielcrrhhstcearyeavsperlelerqhtfalhqrciqakakr
    

  • Chain 'X':
    No sequence available.

  • Chain 'Y':
    No sequence available.