PDB entry 3nbm

View 3nbm on RCSB PDB site
Description: the lactose-specific iib component domain structure of the phosphoenolpyruvate:carbohydrate phosphotransferase system (pts) from streptococcus pneumoniae.
Deposited on 2010-06-03, released 2010-09-08
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PTS system, lactose-specific IIBC components
    Species: STREPTOCOCCUS PNEUMONIAE [TaxId:170187]
    Gene: lacE-1, SP_0478
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nbmA (A:)
    snaskelkvlvlcagsgtsaqlanaineganltevrviansgaygahydimgvydliila
    pqvrsyyremkvdaerlgiqivatrgmeyihltkspskalqfvlehyq
    

    Sequence, based on observed residues (ATOM records):
    >3nbmA (A:)
    kelkvlvlcagsgtsaqlanaineganltevrviansgaygahydimgvydliilapqvr
    syyremkvdaerlgiqivatrgmeyihltkspskalqfvlehyq