PDB entry 3nbi

View 3nbi on RCSB PDB site
Description: crystal structure of human rmi1 n-terminus
Deposited on 2010-06-03, released 2010-09-22
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RecQ-mediated genome instability protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: RMI1, C9orf76
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nbiA (A:)
    sggrnvtsialraetwllaawhvkvppmwleacinwiqeennnvnlsqaqmnkqvfeqwl
    ltdlrdlehpllpdgileipkgelngfyalqinslvdvsqpaysqiqklrgknttndlvt
    aeaqvtpkpweakpsrmlmlqltdgivqiqgmeyqpipilhsdlppgtkiliygnisfrl
    gvlllkpenvkvlggevdalleeyaqekvlarlige
    

    Sequence, based on observed residues (ATOM records):
    >3nbiA (A:)
    nvtsialraetwllaawhvkvppmwleacinwiqeennnvnlsqaqmnkqvfeqwlltdl
    rdlehpllpdgileipkgelngfyalqinslvdvsqpaysqiqklrgkaqvtpkpweakp
    srmlmlqltdgivqiqgmeyqpipilhsdlppgtkiliygnisfrlgvlllkpenvkvlg
    gevdalleeyaqe