PDB entry 3nbc

View 3nbc on RCSB PDB site
Description: clitocybe nebularis ricin b-like lectin (cnl) in complex with lactose, crystallized at ph 4.4
Deposited on 2010-06-03, released 2011-09-21
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.01 Å
R-factor: N/A
AEROSPACI score: 0.8 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ricin B-like lectin
    Species: Clitocybe nebularis [TaxId:117024]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Ricin B-like lectin
    Species: Clitocybe nebularis [TaxId:117024]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: LAT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3nbcA (A:)
    sitpgtynitnvaytnrlidltgsnpaentliighhlnktpsgygnqqwtlvqlphttiy
    tmqavnpqsyvrvrddnlvdgaalvgsqqptpvsiesagnsgqfrikipnlglaltlpsd
    anstpivlgevdetstnqlwafesvsav
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >3nbcB (B:)
    sitpgtynitnvaytnrlidltgsnpaentliighhlnktpsgygnqqwtlvqlphttiy
    tmqavnpqsyvrvrddnlvdgaalvgsqqptpvsiesagnsgqfrikipnlglaltlpsd
    anstpivlgevdetstnqlwafesvsav