PDB entry 3nbb

View 3nbb on RCSB PDB site
Description: Crystal structure of mutant Y305F expressed in E. coli in the copper amine oxidase from hansenula polymorpha
Deposited on 2010-06-03, released 2010-08-25
The last revision was dated 2010-09-08, with a file datestamp of 2010-09-03.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.193
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisomal primary amine oxidase
    Species: Pichia angusta [TaxId:4905]
    Gene: AMO
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12807
      • engineered mutation (304)
  • Chain 'B':
    Compound: Peroxisomal primary amine oxidase
    Species: Pichia angusta [TaxId:4905]
    Gene: AMO
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12807
      • engineered mutation (304)
  • Chain 'C':
    Compound: Peroxisomal primary amine oxidase
    Species: Pichia angusta [TaxId:4905]
    Gene: AMO
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12807
      • engineered mutation (304)
  • Chain 'D':
    Compound: Peroxisomal primary amine oxidase
    Species: Pichia angusta [TaxId:4905]
    Gene: AMO
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12807
      • engineered mutation (304)
  • Chain 'E':
    Compound: Peroxisomal primary amine oxidase
    Species: Pichia angusta [TaxId:4905]
    Gene: AMO
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12807
      • engineered mutation (304)
  • Chain 'F':
    Compound: Peroxisomal primary amine oxidase
    Species: Pichia angusta [TaxId:4905]
    Gene: AMO
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12807
      • engineered mutation (304)
  • Heterogens: CU, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nbbA (A:)
    merlrqiasqataasaaparpahpldplstaeikaatntvksyfagkkisfntvtlrepa
    rkayiqwkeqggplpprlayyvileagkpgvkeglvdlaslsvietraletvqpiltved
    lcsteevirndpavieqcvlsgipanemhkvycdpwtigyderwgtgkrlqqalvyyrsd
    eddsqyshpldfcpivdteekkvifidipnrrrkvskhkhanfypkhmiekvgamrpeap
    pinvtqpegvsfkmtgnvmewsnfkfhigfnyregivlsdvsyndhgnvrpifhrislse
    mivpfgspefphqrkhaldigeygagymtnplslgcdckgvihyldahfsdragdpitvk
    navciheeddgllfkhsdfrdnfatslvtratklvvsqiftaanxeyclywvfmqdgair
    ldirltgilntyilgddeeagpwgtrvypnvnahnhqhlfslridpridgdgnsaaacda
    ksspyplgspenmygnafysekttfktvkdsltnyesatgrswdifnpnkvnpysgkpps
    yklvstqcppllakegslvakrapwashsvnvvpykdnrlypsgdhvpqwsgdgvrgmre
    wigdgsenidntdilffhtfgithfpapedfplxpaepitlmlrprhfftenpgldiqps
    yamttseakravhketkdktsrlafegsccgk
    

    Sequence, based on observed residues (ATOM records):
    >3nbbA (A:)
    saaparpahpldplstaeikaatntvksyfagkkisfntvtlreparkayiqwkeqggpl
    pprlayyvileagkpgvkeglvdlaslsvietraletvqpiltvedlcsteevirndpav
    ieqcvlsgipanemhkvycdpwtigyderwgtgkrlqqalvyyrsdeddsqyshpldfcp
    ivdteekkvifidipnrrrkvskhkhanfypkhmiekvgamrpeappinvtqpegvsfkm
    tgnvmewsnfkfhigfnyregivlsdvsyndhgnvrpifhrislsemivpfgspefphqr
    khaldigeygagymtnplslgcdckgvihyldahfsdragdpitvknavciheeddgllf
    khsdfrdnfatslvtratklvvsqiftaanxeyclywvfmqdgairldirltgilntyil
    gddeeagpwgtrvypnvnahnhqhlfslridpridgdgnsaaacdaksspyplgspenmy
    gnafysekttfktvkdsltnyesatgrswdifnpnkvnpysgkppsyklvstqcppllak
    egslvakrapwashsvnvvpykdnrlypsgdhvpqwsgdgvrgmrewigdgsenidntdi
    lffhtfgithfpapedfplxpaepitlmlrprhfftenpgldiqpsyamttseakravhk
    e
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nbbB (B:)
    merlrqiasqataasaaparpahpldplstaeikaatntvksyfagkkisfntvtlrepa
    rkayiqwkeqggplpprlayyvileagkpgvkeglvdlaslsvietraletvqpiltved
    lcsteevirndpavieqcvlsgipanemhkvycdpwtigyderwgtgkrlqqalvyyrsd
    eddsqyshpldfcpivdteekkvifidipnrrrkvskhkhanfypkhmiekvgamrpeap
    pinvtqpegvsfkmtgnvmewsnfkfhigfnyregivlsdvsyndhgnvrpifhrislse
    mivpfgspefphqrkhaldigeygagymtnplslgcdckgvihyldahfsdragdpitvk
    navciheeddgllfkhsdfrdnfatslvtratklvvsqiftaanxeyclywvfmqdgair
    ldirltgilntyilgddeeagpwgtrvypnvnahnhqhlfslridpridgdgnsaaacda
    ksspyplgspenmygnafysekttfktvkdsltnyesatgrswdifnpnkvnpysgkpps
    yklvstqcppllakegslvakrapwashsvnvvpykdnrlypsgdhvpqwsgdgvrgmre
    wigdgsenidntdilffhtfgithfpapedfplxpaepitlmlrprhfftenpgldiqps
    yamttseakravhketkdktsrlafegsccgk
    

    Sequence, based on observed residues (ATOM records):
    >3nbbB (B:)
    saaparpahpldplstaeikaatntvksyfagkkisfntvtlreparkayiqwkeqggpl
    pprlayyvileagkpgvkeglvdlaslsvietraletvqpiltvedlcsteevirndpav
    ieqcvlsgipanemhkvycdpwtigyderwgtgkrlqqalvyyrsdeddsqyshpldfcp
    ivdteekkvifidipnrrrkvskhkhanfypkhmiekvgamrpeappinvtqpegvsfkm
    tgnvmewsnfkfhigfnyregivlsdvsyndhgnvrpifhrislsemivpfgspefphqr
    khaldigeygagymtnplslgcdckgvihyldahfsdragdpitvknavciheeddgllf
    khsdfrdnfatslvtratklvvsqiftaanxeyclywvfmqdgairldirltgilntyil
    gddeeagpwgtrvypnvnahnhqhlfslridpridgdgnsaaacdaksspyplgspenmy
    gnafysekttfktvkdsltnyesatgrswdifnpnkvnpysgkppsyklvstqcppllak
    egslvakrapwashsvnvvpykdnrlypsgdhvpqwsgdgvrgmrewigdgsenidntdi
    lffhtfgithfpapedfplxpaepitlmlrprhfftenpgldiqpsyamttseakravhk
    e
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3nbbC (C:)
    merlrqiasqataasaaparpahpldplstaeikaatntvksyfagkkisfntvtlrepa
    rkayiqwkeqggplpprlayyvileagkpgvkeglvdlaslsvietraletvqpiltved
    lcsteevirndpavieqcvlsgipanemhkvycdpwtigyderwgtgkrlqqalvyyrsd
    eddsqyshpldfcpivdteekkvifidipnrrrkvskhkhanfypkhmiekvgamrpeap
    pinvtqpegvsfkmtgnvmewsnfkfhigfnyregivlsdvsyndhgnvrpifhrislse
    mivpfgspefphqrkhaldigeygagymtnplslgcdckgvihyldahfsdragdpitvk
    navciheeddgllfkhsdfrdnfatslvtratklvvsqiftaanxeyclywvfmqdgair
    ldirltgilntyilgddeeagpwgtrvypnvnahnhqhlfslridpridgdgnsaaacda
    ksspyplgspenmygnafysekttfktvkdsltnyesatgrswdifnpnkvnpysgkpps
    yklvstqcppllakegslvakrapwashsvnvvpykdnrlypsgdhvpqwsgdgvrgmre
    wigdgsenidntdilffhtfgithfpapedfplxpaepitlmlrprhfftenpgldiqps
    yamttseakravhketkdktsrlafegsccgk
    

    Sequence, based on observed residues (ATOM records):
    >3nbbC (C:)
    saaparpahpldplstaeikaatntvksyfagkkisfntvtlreparkayiqwkeqggpl
    pprlayyvileagkpgvkeglvdlaslsvietraletvqpiltvedlcsteevirndpav
    ieqcvlsgipanemhkvycdpwtigyderwgtgkrlqqalvyyrsdeddsqyshpldfcp
    ivdteekkvifidipnrrrkvskhkhanfypkhmiekvgamrpeappinvtqpegvsfkm
    tgnvmewsnfkfhigfnyregivlsdvsyndhgnvrpifhrislsemivpfgspefphqr
    khaldigeygagymtnplslgcdckgvihyldahfsdragdpitvknavciheeddgllf
    khsdfrdnfatslvtratklvvsqiftaanxeyclywvfmqdgairldirltgilntyil
    gddeeagpwgtrvypnvnahnhqhlfslridpridgdgnsaaacdaksspyplgspenmy
    gnafysekttfktvkdsltnyesatgrswdifnpnkvnpysgkppsyklvstqcppllak
    egslvakrapwashsvnvvpykdnrlypsgdhvpqwsgdgvrgmrewigdgsenidntdi
    lffhtfgithfpapedfplxpaepitlmlrprhfftenpgldiqpsyamttseakravhk
    e
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3nbbD (D:)
    merlrqiasqataasaaparpahpldplstaeikaatntvksyfagkkisfntvtlrepa
    rkayiqwkeqggplpprlayyvileagkpgvkeglvdlaslsvietraletvqpiltved
    lcsteevirndpavieqcvlsgipanemhkvycdpwtigyderwgtgkrlqqalvyyrsd
    eddsqyshpldfcpivdteekkvifidipnrrrkvskhkhanfypkhmiekvgamrpeap
    pinvtqpegvsfkmtgnvmewsnfkfhigfnyregivlsdvsyndhgnvrpifhrislse
    mivpfgspefphqrkhaldigeygagymtnplslgcdckgvihyldahfsdragdpitvk
    navciheeddgllfkhsdfrdnfatslvtratklvvsqiftaanxeyclywvfmqdgair
    ldirltgilntyilgddeeagpwgtrvypnvnahnhqhlfslridpridgdgnsaaacda
    ksspyplgspenmygnafysekttfktvkdsltnyesatgrswdifnpnkvnpysgkpps
    yklvstqcppllakegslvakrapwashsvnvvpykdnrlypsgdhvpqwsgdgvrgmre
    wigdgsenidntdilffhtfgithfpapedfplxpaepitlmlrprhfftenpgldiqps
    yamttseakravhketkdktsrlafegsccgk
    

    Sequence, based on observed residues (ATOM records):
    >3nbbD (D:)
    saaparpahpldplstaeikaatntvksyfagkkisfntvtlreparkayiqwkeqggpl
    pprlayyvileagkpgvkeglvdlaslsvietraletvqpiltvedlcsteevirndpav
    ieqcvlsgipanemhkvycdpwtigyderwgtgkrlqqalvyyrsdeddsqyshpldfcp
    ivdteekkvifidipnrrrkvskhkhanfypkhmiekvgamrpeappinvtqpegvsfkm
    tgnvmewsnfkfhigfnyregivlsdvsyndhgnvrpifhrislsemivpfgspefphqr
    khaldigeygagymtnplslgcdckgvihyldahfsdragdpitvknavciheeddgllf
    khsdfrdnfatslvtratklvvsqiftaanxeyclywvfmqdgairldirltgilntyil
    gddeeagpwgtrvypnvnahnhqhlfslridpridgdgnsaaacdaksspyplgspenmy
    gnafysekttfktvkdsltnyesatgrswdifnpnkvnpysgkppsyklvstqcppllak
    egslvakrapwashsvnvvpykdnrlypsgdhvpqwsgdgvrgmrewigdgsenidntdi
    lffhtfgithfpapedfplxpaepitlmlrprhfftenpgldiqpsyamttseakravhk
    e
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >3nbbE (E:)
    merlrqiasqataasaaparpahpldplstaeikaatntvksyfagkkisfntvtlrepa
    rkayiqwkeqggplpprlayyvileagkpgvkeglvdlaslsvietraletvqpiltved
    lcsteevirndpavieqcvlsgipanemhkvycdpwtigyderwgtgkrlqqalvyyrsd
    eddsqyshpldfcpivdteekkvifidipnrrrkvskhkhanfypkhmiekvgamrpeap
    pinvtqpegvsfkmtgnvmewsnfkfhigfnyregivlsdvsyndhgnvrpifhrislse
    mivpfgspefphqrkhaldigeygagymtnplslgcdckgvihyldahfsdragdpitvk
    navciheeddgllfkhsdfrdnfatslvtratklvvsqiftaanxeyclywvfmqdgair
    ldirltgilntyilgddeeagpwgtrvypnvnahnhqhlfslridpridgdgnsaaacda
    ksspyplgspenmygnafysekttfktvkdsltnyesatgrswdifnpnkvnpysgkpps
    yklvstqcppllakegslvakrapwashsvnvvpykdnrlypsgdhvpqwsgdgvrgmre
    wigdgsenidntdilffhtfgithfpapedfplxpaepitlmlrprhfftenpgldiqps
    yamttseakravhketkdktsrlafegsccgk
    

    Sequence, based on observed residues (ATOM records):
    >3nbbE (E:)
    saaparpahpldplstaeikaatntvksyfagkkisfntvtlreparkayiqwkeqggpl
    pprlayyvileagkpgvkeglvdlaslsvietraletvqpiltvedlcsteevirndpav
    ieqcvlsgipanemhkvycdpwtigyderwgtgkrlqqalvyyrsdeddsqyshpldfcp
    ivdteekkvifidipnrrrkvskhkhanfypkhmiekvgamrpeappinvtqpegvsfkm
    tgnvmewsnfkfhigfnyregivlsdvsyndhgnvrpifhrislsemivpfgspefphqr
    khaldigeygagymtnplslgcdckgvihyldahfsdragdpitvknavciheeddgllf
    khsdfrdnfatslvtratklvvsqiftaanxeyclywvfmqdgairldirltgilntyil
    gddeeagpwgtrvypnvnahnhqhlfslridpridgdgnsaaacdaksspyplgspenmy
    gnafysekttfktvkdsltnyesatgrswdifnpnkvnpysgkppsyklvstqcppllak
    egslvakrapwashsvnvvpykdnrlypsgdhvpqwsgdgvrgmrewigdgsenidntdi
    lffhtfgithfpapedfplxpaepitlmlrprhfftenpgldiqpsyamttseakravhk
    e
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >3nbbF (F:)
    merlrqiasqataasaaparpahpldplstaeikaatntvksyfagkkisfntvtlrepa
    rkayiqwkeqggplpprlayyvileagkpgvkeglvdlaslsvietraletvqpiltved
    lcsteevirndpavieqcvlsgipanemhkvycdpwtigyderwgtgkrlqqalvyyrsd
    eddsqyshpldfcpivdteekkvifidipnrrrkvskhkhanfypkhmiekvgamrpeap
    pinvtqpegvsfkmtgnvmewsnfkfhigfnyregivlsdvsyndhgnvrpifhrislse
    mivpfgspefphqrkhaldigeygagymtnplslgcdckgvihyldahfsdragdpitvk
    navciheeddgllfkhsdfrdnfatslvtratklvvsqiftaanxeyclywvfmqdgair
    ldirltgilntyilgddeeagpwgtrvypnvnahnhqhlfslridpridgdgnsaaacda
    ksspyplgspenmygnafysekttfktvkdsltnyesatgrswdifnpnkvnpysgkpps
    yklvstqcppllakegslvakrapwashsvnvvpykdnrlypsgdhvpqwsgdgvrgmre
    wigdgsenidntdilffhtfgithfpapedfplxpaepitlmlrprhfftenpgldiqps
    yamttseakravhketkdktsrlafegsccgk
    

    Sequence, based on observed residues (ATOM records):
    >3nbbF (F:)
    saaparpahpldplstaeikaatntvksyfagkkisfntvtlreparkayiqwkeqggpl
    pprlayyvileagkpgvkeglvdlaslsvietraletvqpiltvedlcsteevirndpav
    ieqcvlsgipanemhkvycdpwtigyderwgtgkrlqqalvyyrsdeddsqyshpldfcp
    ivdteekkvifidipnrrrkvskhkhanfypkhmiekvgamrpeappinvtqpegvsfkm
    tgnvmewsnfkfhigfnyregivlsdvsyndhgnvrpifhrislsemivpfgspefphqr
    khaldigeygagymtnplslgcdckgvihyldahfsdragdpitvknavciheeddgllf
    khsdfrdnfatslvtratklvvsqiftaanxeyclywvfmqdgairldirltgilntyil
    gddeeagpwgtrvypnvnahnhqhlfslridpridgdgnsaaacdaksspyplgspenmy
    gnafysekttfktvkdsltnyesatgrswdifnpnkvnpysgkppsyklvstqcppllak
    egslvakrapwashsvnvvpykdnrlypsgdhvpqwsgdgvrgmrewigdgsenidntdi
    lffhtfgithfpapedfplxpaepitlmlrprhfftenpgldiqpsyamttseakravhk
    e